KEGG   Actinomyces gaoshouyii: B6G06_03975Help
Entry
B6G06_03975       CDS       T04911                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
actp  Actinomyces gaoshouyii
Pathway
actp00020  Citrate cycle (TCA cycle)
actp01100  Metabolic pathways
actp01110  Biosynthesis of secondary metabolites
actp01120  Microbial metabolism in diverse environments
actp01130  Biosynthesis of antibiotics
actp01200  Carbon metabolism
Module
actp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
actp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:actp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B6G06_03975
  09105 Amino acid metabolism
   00310 Lysine degradation
    B6G06_03975
   00380 Tryptophan metabolism
    B6G06_03975
Enzymes [BR:actp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     B6G06_03975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ARD41604
UniProt: A0A1V0KIP2
LinkDB All DBs
Position
complement(968442..970121)
Genome map
AA seq 559 aa AA seqDB search
MSESVKMPALGESVTEGTVSSWLKAVGESVTADEPLVEVATDKVDTEVPAPASGVLLEIR
VPEDETVEVGTVLAIIGEPSEAGSAPAPEATPAPQAAAPAAPAPATPAPTAAPTGEGTEV
TMPALGESVTEGTVSSWLKAVGESVTADEPLVEVATDKVDTEVPAPASGVLLEIRVPEDE
TVEVGTVLAIIGEPSEAGSAPAPEATPAPQAAAPAAPAPATPAPTAAPTGEASAPAAPSA
VAVAAAGYVTPIVRKLAREKGVDLTQVTGTGVGGRIRKEDVLTAAKAAEEAAARAAAAQS
ASTAAPAPAAAPSAEPAADTALRGKTEKMSRLRQVISERMIDSLQTSAQLTTVVEVDVTR
VAALRAKAKDAFLAANGTKLTFLPFFVQAATEALKAHPKVNASINGKEVTYHDAEHVGIA
VDTPRGLLVPVVKNAGDLNIPGLAKRINDLAARTRDNKVNPDELSGSTFTITNTGSGGAL
FDTPIINQPEVAILGLGAIVKQPRVIKDADGYEVIAIRSVCYLALSYDHRLVDGADAARY
LMTVKKRLEDGDFAGELGL
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaatccgtcaagatgcccgctctgggcgagtccgtcaccgagggcacagtctcc
tcctggctcaaggccgtgggcgagtccgtcaccgccgacgagcccctggtcgaggtcgcc
accgacaaggtcgacaccgaggtccccgcccccgcctccggcgtcctgctcgagatccgc
gtccccgaggacgagaccgtcgaggtcggcaccgtcctggccatcatcggagagccctcc
gaggccggctccgcccccgcccccgaagcgaccccggcgccccaggcggccgccccagcg
gctcccgcgccggctaccccggctcccaccgccgcacccaccggcgagggcaccgaggtg
accatgcccgctctgggcgagtccgtcaccgagggcacagtctcctcctggctcaaggcc
gtgggcgagtccgtcaccgccgacgagcccctggtcgaggtcgccaccgacaaggtcgac
accgaggtccccgcccccgcctccggcgtcctgctcgagatccgcgtccccgaggacgag
accgtcgaggtcggcaccgtcctggccatcatcggagagccctccgaggccggctccgcc
cccgcccccgaagcgaccccggcgccccaggcggccgccccagcggctcccgcgccggct
accccggctcccaccgccgcacccaccggcgaggcatccgcaccggcggccccgtcggcc
gtggccgtggccgcggcgggctacgtcaccccgatcgtgcgcaagctcgctcgcgagaag
ggcgtcgacctgacccaggtgaccggcaccggtgtgggaggccgtatccgcaaggaggac
gtgctgaccgctgccaaggcggccgaggaggccgcggccagggcggccgccgcccagtcg
gcttccactgccgcgccggcccccgccgcggcgccgtcggccgagcccgccgcggacacc
gcgctgcgcggcaagaccgagaagatgagccgcctgcgccaggtcatctccgagcgcatg
atcgactcgctgcagacctccgcccagctgaccacggtcgtcgaggtggacgtcacccgc
gtcgccgcgctgcgcgccaaggcgaaggacgcgttcctggccgctaacggcacgaagctc
accttcctgcccttcttcgtgcaggccgccaccgaggccctcaaggcccacccgaaggtg
aacgcatccatcaacggcaaggaggtcacctatcacgatgccgagcacgtcggcatcgcc
gtggacaccccgcgcggcctgctcgtccccgtggtcaagaacgccggggacctcaatatc
ccgggcctggccaagcgcatcaacgacctggccgcccgcacccgtgacaacaaggtgaac
ccggacgagctctccggctccaccttcaccatcaccaataccggctccggtggtgccctg
ttcgacaccccgatcatcaaccagcccgaggtcgcgatcctgggactgggcgcgatcgtc
aaacagccgcgcgtcatcaaggacgctgatggctacgaggttattgcgatccgttccgtg
tgctacctggccctgtcctacgaccaccgcctggtggacggggccgacgccgcgcgctac
ctcatgaccgtcaagaagcgcctcgaggacggcgacttcgccggcgagctcggcctgtga

DBGET integrated database retrieval system