KEGG   Actinomyces gaoshouyii: B6G06_06800Help
Entry
B6G06_06800       CDS       T04911                                 

Definition
(GenBank) alcohol dehydrogenase
Organism
actp  Actinomyces gaoshouyii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 2-Hacid_dh_C Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: ARD42084
UniProt: A0A1V0KK12
LinkDB All DBs
Position
complement(1655734..1656888)
Genome map
AA seq 384 aa AA seqDB search
MTSNDAVQNPDIPDTMRAAVLRDTAKGLEVETLRTPRPKAGEVLIKVAACGLCHSDLHVI
GGAIAFPLPAVLGHEVTGTIVEVGPGNEHTGLAVGQNVAGGFLMPCGQCDACAEGRDELC
GPFFELNRLKGVLYDGATRLATPEGESVAMYSMGGLAEYAVVPSTSVAVVPDSIDMVPAA
ILGCAAMTGYGAVRRGADLRFGETVAVVATGGVGTNIVQIARAFGASQVIAIDVSDDKLA
PMVGYGATAVVNAATHDAREEVLKLTGGKGVDVAFEALGIPATWTTALDVLADGGRMVPI
GLGAGVQTAGVEINRTVRRSQRILGSYGARTRQDLPAVVDLAARGVINYKDVVSQCFPLQ
EAGAGYEALRNRRIQGRAVVDMSL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcaacgacgcagtccagaaccccgacatccccgataccatgcgtgcggccgtc
ctgcgcgacaccgccaaaggcctcgaggtcgagaccctgcgcaccccccggcccaaggcc
ggcgaggtcctcatcaaggtcgccgcctgcggcctgtgccactccgatctccacgtcatc
ggcggcgccatcgccttccccctgcccgccgtcctcggccacgaggtcaccggcaccatc
gtcgaggtcggccccggcaacgagcacaccggcctggccgtcgggcagaacgtggccggg
ggcttcctcatgccctgcgggcagtgcgatgcctgcgccgaggggcgtgacgagctgtgc
ggccccttcttcgagctcaaccgcttgaagggcgtcctctacgacggcgccacccggctg
gccaccccggagggcgagagcgtcgccatgtactccatgggcggcctcgccgagtacgcc
gtcgtcccgtccacatccgtggccgttgtgcccgactcgatcgacatggtgcccgccgcc
atcctcggctgcgccgcgatgaccggctacggcgccgtgcgccgcggtgcggacctgcgc
ttcggggagacggtcgccgtcgtcgccaccgggggagtgggcacgaacatcgtgcagatc
gcccgcgctttcggggccagtcaggtcatcgccatcgacgtctccgacgacaagctcgcc
cccatggtgggttacggcgccaccgccgtggtcaacgctgcgactcacgacgcccgcgag
gaggtcctcaagctgaccgggggcaagggcgtcgatgtcgccttcgaggccctgggcatc
cccgccacctggaccaccgccctcgatgtgctggccgacggcggccgcatggtgccgatc
ggcctgggcgccggcgtgcagaccgcgggtgtcgagatcaaccgcaccgtgcgccgcagt
cagaggatcctgggctcctacggtgcgcggacccgccaggacctgcccgccgtcgtcgac
ctcgcggcgcgcggcgtcatcaactacaaggacgtggtgtcccagtgcttccccctgcag
gaggccggggccggctacgaggcgctgcgcaaccgccggatccagggacgcgccgtcgtc
gacatgtccctgtag

DBGET integrated database retrieval system