KEGG   Actinoplanes sp. SE50: ACWT_0404Help
Entry
ACWT_0404         CDS       T05392                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
acts  Actinoplanes sp. SE50
Pathway
acts03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:acts00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    ACWT_0404
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:acts03400]
    ACWT_0404
Enzymes [BR:acts01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     ACWT_0404
DNA repair and recombination proteins [BR:acts03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     ACWT_0404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ATO79819
LinkDB All DBs
Position
complement(473363..474268)
Genome map
AA seq 301 aa AA seqDB search
MPDRIPIRLDGHDLELSNLDKVLFPATGVTKAEVIDYYTRIAPVLLPHLRDRPVTRIRYP
NGVEGAHFFEKNKPAGTPDWVRLVTLPVPGSTKSRETVEFVVVDELATLVWLANLAAIEL
HTPQWRVGAHPDMLVVDLDPGAPAGLRECSAVAVLMRDRLAEDGIAAFPKTSGKKGMQLC
CPISGAQDAGVVSGYAKRVAEELARLVPGSITAKMAKQLRPGKIFIDWSQNNAAKTTVTP
YSLRAGPAPTASTPLTWPETEAMAIGDAEARQFTAAEALDRAQTHGDLLTGLLESGPAVP
V
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaccggatcccgatccgcctggacggccatgacctggagctgtccaacctcgac
aaggtgctgttcccggcgaccggcgtgaccaaggccgaggtgatcgactactacacccgg
atcgccccggttctgctgccgcatctgcgcgaccgcccggtcacccggatccgctatccg
aacggtgtcgagggcgcgcacttcttcgagaagaacaagccggccggcaccccggactgg
gtgcgcctggtgacgctgcccgtcccggggtccaccaagagccgggagaccgtcgagttc
gtggtcgtcgacgaactggccaccctggtctggctggccaatctggccgcgatcgagctg
cacaccccgcagtggcgggtcggtgcccacccggacatgctggtcgtcgatctggacccg
ggggcgccggccgggctgcgcgagtgttccgcggtggcggtgctgatgcgcgaccggctg
gccgaggacgggatcgccgcgttcccgaagacgtccggcaagaaggggatgcagctgtgc
tgcccgatctcgggtgcccaggacgccggggtggtctccgggtacgccaaacgggtggcc
gaggagctggcgcggctggtgccggggtcgatcaccgcgaagatggccaagcagctgcgg
ccgggaaagatcttcatcgactggagccagaacaacgcggccaagaccacggtcaccccg
tactccctgcgggccggcccggcgccgaccgcgtcgacgccgctgacctggccggaaacc
gaggcgatggccatcggggacgcggaggcccgccagttcaccgcggcggaggcgctggac
cgcgcacaaacccacggtgacctgctgaccggcctgctcgagtcgggtcccgccgtgccg
gtttga

DBGET integrated database retrieval system