KEGG   Actinoplanes sp. SE50: ACWT_0405Help
Entry
ACWT_0405         CDS       T05392                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
acts  Actinoplanes sp. SE50
Pathway
acts03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:acts00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    ACWT_0405
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:acts03400]
    ACWT_0405
Enzymes [BR:acts01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     ACWT_0405
DNA repair and recombination proteins [BR:acts03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     ACWT_0405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: ATO79820
LinkDB All DBs
Position
complement(474261..475175)
Genome map
AA seq 304 aa AA seqDB search
MLATAGDLPVGTEWSYEFKWDGVRVLALFSGGPPELYARSGAVVTAAYPEIADLHLPEGT
LLDGEMVCFDAAGRPSFTALAERMHVRDRQRAARLAVTLPATYLIFDLLYLDGMDYTGLP
YLARRERLEELDLAGQRWMVPPSFGDGAATAAAARENQLEGVMAKRSDSVYLPGQRSADW
VKVKFDRTGDYVIGGWRPGARKLGGLLIGVPTPAGLAFRGRVGGGIGAVAERDLLDRLAP
LAAPDSPFAPGAVPRADAKGAHWVRPELVAEIKYGNQTPDRRLRFPRFLRLRSDKSPAEC
TDDA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgctcgccacggcgggcgacctgcccgtgggcacggagtggagctacgagttcaagtgg
gacggggtgcgcgttctcgcactgttcagcggcggcccgccggagctgtacgcccggtcc
ggggcggtggtgaccgcggcgtacccggagatcgccgatctgcacctgcccgagggcacc
ctgctggacggggagatggtctgtttcgacgcggccggccgcccgtcgttcaccgcgctg
gccgagcggatgcacgtccgggaccggcagcgcgccgcccgcctcgcggtcaccctgccg
gccacctacctgatcttcgacctgctctacctggacggcatggactacaccggcctgccc
tacctggcccgccgggagcgtctggaggagctggatctggccgggcagcgctggatggtg
ccgccgtcgttcggcgacggcgcggccaccgcggcggccgcccgggagaaccagctggag
ggggtgatggccaagcgttccgactcggtgtacctgcccggccagcgatccgcggactgg
gtcaaggtgaagttcgaccgcaccggcgactatgtgatcggcggctggcgcccgggcgcg
cgcaagctcggcggcctgctgatcggcgtgccgactccggcgggcctggcgttccggggc
cgggtcggcggcggtatcggcgccgtcgccgagcgggatctgctcgaccggctggcgccg
ctcgccgcaccggattcgccgttcgctcccggcgcggtgccgcgcgcggatgccaaaggc
gcccactgggtacgcccggagctggtcgccgagatcaagtacggcaaccagacccccgac
cgccggctgcggttcccccgcttcctgcggttgcgctcggacaagtcgcccgcggagtgc
accgacgatgcctga

DBGET integrated database retrieval system