KEGG   Actinoplanes sp. SE50: ACWT_0808Help
Entry
ACWT_0808         CDS       T05392                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
acts  Actinoplanes sp. SE50
Pathway
acts00620  Pyruvate metabolism
acts00680  Methane metabolism
acts01100  Metabolic pathways
acts01120  Microbial metabolism in diverse environments
acts01200  Carbon metabolism
Module
acts_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:acts00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ACWT_0808
  09102 Energy metabolism
   00680 Methane metabolism
    ACWT_0808
Enzymes [BR:acts01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ACWT_0808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase Phage_TAC_6
Motif
Other DBs
NCBI-ProteinID: ATO80223
LinkDB All DBs
Position
complement(917145..919943)
Genome map
AA seq 932 aa AA seqDB search
MTELPAHLDEREGPDAELRADIRRIGTLLGQTLARQEGRPLLDLVEEIRALVRQDVPAAA
ERLAAMDITTGTKLARAFSTYFHLANITEQVHRARDLRRRRAKDGGWLDQAAKRIAERGV
PADEIASAARRLAVRPVFTAHPTEASRRSILSKLRQVADSLDAESAAAALYGDTDTTQST
KRFAELIDLLWQTDELRLDRPDPTDEARNAVYYLKDLYAEAAPQVLDDLAETLRRLGVET
APTSRPLTFGSWIGGDRDGNPFVTPAVTAAVLLIQHEHGIQATEKVMDKLIEELSVSRRL
RGVSLDLSASLAQDLDNLPEVADRFRRVNAEEPYRLKVRAIKAKLANTRSRLQHGTPHVA
GRDYLGSDELIADLELMRASLARNSGQLPAVGVVATAIRQASAFGLQLATLDVREHAEKH
HEVLQQMYTQVGEVEDYAALDRTERTKLLAAELTGRRPLSSADTPLTDSARKTFDVFNTI
RESQERFGADVIETYIISMTLGVDDVLAAAVLAREAGLVDIHTGRARVNIVPLLETPAEL
DAGGDLLDEMLSLPAYRAIVRARGDVQEVMLGYSDSNKEAGITTSQWRIHKAQRSLRDVA
ARHGVRLRLFHGRGGTVGRGGGPTHEAILAQPYGTLDGAIKVTEQGEVISDKYTVPALAR
ENLELTTAAVLQATLLHTTLSVDPVRLEVWDATMDTTSEAAFAAYRRLVENPDLPAYFWA
ATPTELLGALNIGSRPAKRPNADAGLGGLRAIPWVFGWTQTRQIVPGWFGVGTGLAAARK
AGLGDVLTEMHDNWQFFRTFLSNVAMMLAKTDLSIARRYVETLVPEELHPIFATIEAEYD
RTVQEVLAITGEPRILAAQPELSRTLGVRDTYLEPLHHLQVALLRQYRDLSDAARQMPTA
PGARRGPSDSTALERALLTTVNGIAAGMRNTG
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgacagagctgcccgcccatctcgacgagcgagaggggcccgacgccgagctccgtgcc
gacatccgccggatcggcaccctgctcgggcagaccctggcccgccaggaaggccggccg
ctgctcgacctggtcgaggagatccgcgccctggtccgccaggacgtgccggccgccgcc
gagcggctcgccgcgatggacatcaccaccggcaccaagctggcccgggccttctccacc
tacttccacctggccaacatcaccgaacaggtgcaccgcgcccgcgacctgcggcgccgc
cgggccaaggacggcggctggctggaccaggccgccaagcggatcgccgagcggggcgtc
ccggccgacgagatcgcctcggccgcccgccggctcgcggtccgcccggtcttcaccgcc
cacccgaccgaggcgtcgcgccggtcgatcctgtcgaagctgcgccaggtcgccgactcg
ctggacgccgagtcggccgccgccgcgctctacggcgacaccgacaccacgcagtccacc
aagcggttcgccgagctgatcgacctgctctggcagaccgacgagctgcgtctcgaccgg
ccggacccgaccgacgaggcccgcaacgcggtctactacctcaaggacctgtacgccgag
gctgccccgcaggtcctcgacgacctggccgagacgctgcgccggctgggtgtggagacc
gcgcccacgtcccgcccgctgaccttcggctcgtggatcggcggcgaccgcgacggcaac
ccgttcgtcacccccgcggtcaccgccgccgtgctgctcatccagcacgagcacggcatt
caggccaccgagaaggtgatggacaagctgatcgaggagctgtccgtctcccgccggctg
cgcggggtctccctcgacctgtccgccagcctcgcccaggacctggacaacctgcccgag
gtcgccgaccggttccgccgggtcaacgccgaggagccgtaccggctcaaggtccgggcg
atcaaggcgaagctggccaacacccggtcccggctgcagcacggcaccccgcacgtggcc
ggccgcgattacctgggcagcgacgagctgatcgccgacctggaactgatgcgcgcctcg
ctggcccgcaactccggccagctgcccgcggtcggcgtggtcgccaccgcgatccgccag
gcgtccgcgttcggcctgcagctggccaccctcgacgtgcgcgagcacgccgagaagcac
cacgaggtgctccagcagatgtacacgcaggtcggcgaggtcgaggactacgccgccctg
gaccgcaccgagcgcaccaagctgctcgccgccgaactgaccgggcgccggccgctgtcc
agcgccgacaccccgctgaccgactcggcgcgcaagaccttcgacgtgttcaacacgatc
cgcgagtcgcaggagcggttcggggcggacgtcatcgagacgtacatcatctcgatgacg
ctgggcgtcgacgacgtgctcgccgcggccgtgctggcccgcgaggccggcctggtcgac
atccacaccggccgggcccgggtcaacatcgtgccgctgctggagaccccggccgaactg
gacgccggcggcgacctgctcgacgagatgctgtcgctgcccgcctaccgggcgatcgtc
cgggcccgcggcgacgtgcaggaggtcatgctcggctactcggactccaacaaggaggcc
gggatcaccaccagccagtggcgcatccacaaggcgcagcgctcgctgcgtgacgtggcc
gcccggcacggcgtccggctgcgcctgttccacggccgcggcggcaccgtcggccgcggc
ggcggccccacccacgaggcgatcctggcccagccgtacggcaccctcgacggcgcgatc
aaggtcaccgagcagggtgaggtgatctccgacaagtacaccgtgcccgccctggcccgg
gagaacctggagctcaccacggccgccgtgctgcaggccaccctgctgcacaccacgctg
tcggtcgacccggtccgcctcgaggtgtgggacgcgaccatggacaccacctcggaagcg
gcgttcgccgcctaccgccggctggtggagaacccggacctgcccgcctacttctgggcg
gccacccccaccgaactgctcggcgcgctcaacatcggctcccgccccgcgaaacgcccc
aacgccgacgccggcctgggcggcctgcgcgccatcccgtgggtgttcggctggacccag
acccggcagatcgtccccggctggttcggcgtcggcaccggcctggccgccgcccgcaag
gccggcctcggcgacgtgctcaccgagatgcacgacaactggcagttcttccgcaccttc
ctgtcgaacgtcgcgatgatgctggccaagaccgacctgtcgatcgcccgccgctacgtc
gagacactcgtcccggaggaactgcacccgatcttcgccaccatcgaagccgaatacgac
cgcaccgtccaggaggtcctcgccatcaccggcgagccccgcatcctggcggcgcagccg
gaactctcccgcaccctcggcgtccgcgacacgtacctggagccgctgcaccacctccag
gtcgccctgctccgccagtaccgcgacctgagcgacgcggcccgccagatgccgaccgcg
ccgggcgcccgccgcggcccgtcggactcgacggcgttggaacgcgccctgctcaccacg
gtcaacggcatcgccgccggcatgcgcaacaccggctga

DBGET integrated database retrieval system