KEGG   Actinoplanes sp. SE50: ACWT_3951Help
Entry
ACWT_3951         CDS       T05392                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
acts  Actinoplanes sp. SE50
Pathway
acts00250  Alanine, aspartate and glutamate metabolism
acts00280  Valine, leucine and isoleucine degradation
acts00310  Lysine degradation
acts00410  beta-Alanine metabolism
acts00640  Propanoate metabolism
acts00650  Butanoate metabolism
acts01100  Metabolic pathways
acts01120  Microbial metabolism in diverse environments
Module
acts_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:acts00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ACWT_3951
   00650 Butanoate metabolism
    ACWT_3951
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ACWT_3951
   00280 Valine, leucine and isoleucine degradation
    ACWT_3951
   00310 Lysine degradation
    ACWT_3951
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ACWT_3951
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:acts01007]
    ACWT_3951
Enzymes [BR:acts01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ACWT_3951
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     ACWT_3951
    2.6.1.48  5-aminovalerate transaminase
     ACWT_3951
Amino acid related enzymes [BR:acts01007]
 Aminotransferase (transaminase)
  Class III
   ACWT_3951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ATO83366
LinkDB All DBs
Position
complement(4494157..4495497)
Genome map
AA seq 446 aa AA seqDB search
MNRLCRVSLEQKRRLVTALPGPRSQELMERKLAAVAGGVGTTMPVFAARAGGGIVVDVDG
NHLIDLGSGIAVTTVGAGAPRVVAAVTEQVAAFTHTCFMVTPYDGYVAVAEALNRVTPGD
HEKRSVLFNSGAEAVENAVKIARAHTGRDAVVVFDHAYHGRTNLTMAMTAKSMPYKHGFG
PFAPEVYRAPGSYPYRDAGVDGRAAAARAIDQIEKQIGADNLAALVIEPIQGEGGFIEPA
AGFLPALAAWCRANGVVFVADEVQTGFARTGDMFACDREGVVPDLIVTAKGIAGGLPLSA
VTGRAEIMDAPHAGGLGGTYGGNPIACAAALAAIETIEQDGLLARAREIETRVTGRLHDI
RDKDDRLGDIRGRGAMIAVELVRAGGREADPRLARDVARYAHQRGVIVLTCGTYGNVLRF
LPPLSITNELLDDAFDVLAAAFQEIR
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtgaacagactgtgccgcgtgagcctcgaacagaagcgccggctggtcaccgcactgccc
ggcccccggtcccaggaactgatggaacgcaagctggccgcggtcgccggcggtgtcggc
accacgatgccggtgttcgcggcgcgggccggcggcggcatcgtggtcgacgtcgacggc
aaccacctgatcgacctcggctccggcatcgcggtcaccaccgtgggcgccggcgcgccg
cgggtggtcgccgccgtcaccgagcaggtggcggcgttcacgcacacctgtttcatggtt
acgccgtacgacggttacgtggccgtcgccgaggccctgaaccgcgtcacccccggtgac
cacgagaagcgcagcgtgctgttcaactccggcgcggaagccgtggagaacgccgtgaag
atcgcccgggcgcacaccggcagggacgcggtggtcgtcttcgatcacgcataccacggc
cggacgaacctgaccatggcgatgaccgcgaagagcatgccctacaagcacgggttcggg
ccgttcgcgcccgaggtgtaccgggcgcccgggtcgtatccgtaccgggacgccggcgtc
gacggccgggccgccgcggcgcgggccatcgaccagatcgagaagcagatcggcgcggac
aacctggccgcgctggtgatcgagccgatccagggcgagggcgggttcatcgagccggcc
gccggattcctgccggcgctcgccgcctggtgccgggccaacggcgtggtgttcgtggcc
gacgaggtgcagaccgggttcgcccgcaccggcgacatgttcgcctgcgaccgcgagggc
gtggtacccgacctgatcgtcaccgcgaagggcatcgccggcgggctgccgctgtccgcg
gtgaccgggcgcgccgagatcatggacgcgccgcacgccggcgggctgggcggcacctac
ggcggcaacccgatcgcctgcgccgcggccctcgccgcgatcgagaccatcgagcaggac
gggctgctcgcccgggcccgcgagatcgagacccgggtgaccgggcggctgcatgacatc
cgggacaaggacgaccggctcggtgacatccgcggacgcggcgcgatgatcgcggtcgag
ctggtccgggccgggggccgcgaagccgacccgcggctggcccgggacgtcgcccggtac
gcccatcagcgcggcgtgatcgtcctgacctgcggaacgtacggcaatgttctccgattc
ctgccgccgttgtcgatcaccaatgagctgctcgatgacgcgttcgacgtgctggccgcc
gcattccaggagattcgatga

DBGET integrated database retrieval system