KEGG   Actinoplanes sp. SE50: ACWT_4134Help
Entry
ACWT_4134         CDS       T05392                                 

Definition
(GenBank) alcohol dehydrogenase
Organism
acts  Actinoplanes sp. SE50
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C 2-Hacid_dh_C 3HCDH_N F420_oxidored ORF11CD3
Motif
Other DBs
NCBI-ProteinID: ATO83549
LinkDB All DBs
Position
4688172..4689404
Genome map
AA seq 410 aa AA seqDB search
MAFYTTGLVITPRPGMTAMIRIGASAAPAIRRVRRVGPRLSWRATRLRDRLANRIEEAPR
MRAAVKTADGTFTVEQVDSPELPGPDWARIRVRVAGVCGTDLRHWKVPDPAVTGRVMGHE
VAGEVAEVGPGVSDLNPGDRVVVETVMGDGVCPWCRVRRYNICPHLYDVRTRTVSRAYAE
FLVAPRAKLYRLPERISFEEAALVDTLSVCLHAQHLSGLSIGDRVAVLGAGPIGLGQLML
AKATGARVIISDVVASSRRMARELGADAVVDAANEDVVARVMEFTGGRGADVVFECVGGP
AMPVTLPQATRAARRGAAVVVVGGFDEGDVEIALPWQDIQKSEIRILPSASFAVHELDPE
QGMVVDLLASGMLDAQRLITHRFPLERINEAFETAADKSGTGAVFVAISV
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggccttctatacgacgggcctcgtcatcacgccccggccgggcatgaccgccatgatc
cggattggcgcatccgcggccccggcgatccgtagagtgcgaagagtcggcccccggctg
agctggcgtgccactcgcctgcgcgaccggctcgcgaaccggatcgaggaggcgccgcgc
atgcgggcagcggtcaagacagcggacgggacattcaccgtcgaacaagtcgactcgccg
gagcttcccggcccggactgggcccggatccgggtgcgtgtggccggtgtctgtggaacg
gatctgcggcactggaaggtccccgatcccgcggtgacgggccgtgtcatgggacatgag
gtggccggcgaggtcgccgaggtgggaccgggcgtgtcagacctgaacccgggcgaccgc
gtggtggtcgaaaccgtgatgggtgacggtgtctgcccatggtgccgggtccgccgctac
aacatctgcccccatctgtacgacgtgcgtacgcgcaccgtctcgcgcgcctacgccgag
ttcctcgtcgcgccgcgggcgaagctgtaccggctcccggagcggatcagtttcgaggag
gcggcgctcgtcgacacgctttcggtgtgcctgcatgcgcagcatctgagcgggctctcg
atcggcgaccgggtcgccgtgctcggcgccggcccgatcgggctgggccaactgatgctc
gccaaggccaccggcgcccgggtgatcatcagtgacgtggtggcgtcgtcgcggcgcatg
gcccgcgagctgggggcggacgccgtcgtcgacgccgcgaacgaggacgtcgtcgcccgg
gtgatggagttcacgggcggtcggggcgctgacgtcgtgttcgagtgcgtgggcggcccg
gcgatgccggtgacgctcccgcaagccacccgggcggcgcgccgcggcgcagcggtcgtg
gtggtgggcggcttcgacgagggtgacgtggagatcgcactgccgtggcaggacatccag
aagtcggaaatccggatcctgcccagcgccagtttcgccgtgcacgagctcgacccggaa
cagggcatggtggtcgacctgctggccagcggcatgctcgacgcccagcgattgatcacc
caccggttcccgctggaacgcatcaacgaggcgttcgagaccgcggccgacaagagcggc
accggggcggtcttcgtggcgatcagcgtgtga

DBGET integrated database retrieval system