KEGG   Actinoplanes sp. SE50: ACWT_5495Help
Entry
ACWT_5495         CDS       T05392                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
acts  Actinoplanes sp. SE50
Pathway
acts00564  Glycerophospholipid metabolism
acts01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acts00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ACWT_5495
Enzymes [BR:acts01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ACWT_5495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 3HCDH_N NAD_binding_8 HI0933_like GIDA Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ATO84910
LinkDB All DBs
Position
complement(6151745..6153436)
Genome map
AA seq 563 aa AA seqDB search
MTVLSPERRDAALAALAAAEVDVLVIGGGVVGAGCALDAVTRGLSVGLVEARDFASGTSS
RSSKLIHGGLRYLEMLDFGLVHEALRERGLILSRLAPHLARPVRFLYPLQHRGWERLYTG
AGVALYDTMAWSGSLPNHRHLTRRGALRACPALRKESLVGALQYYDAQVDDARHTMFLAR
TAAAYGAHVANRVEVVGFLREGERVTGVTVRDLEYDRTFEIRAQQVINATGVWTDETQSL
VGERGQFHVRASKGIHLVVPRDRIQSTTGLILRTASSVLFVIPWGRHWIVGTTDTDWALD
KAHPAASAKDIDYLLTEVNKVLARPLERADVQGVYAGLRPLLSGESESTSKLSREHMVGS
PVPGLVVVAGGKYTTYRVMAKDAVDACAFNLNRSVARCCTDRIPLLGAEGYPALWNRRGL
IAAGSGLHIARVEHLLGRYGSLIHDLLALIEDDPTLGRPLTGADDYLRAEVVYAAAAEGA
RHLVDVLTRRTRISIETFDRGTSSAAEAAELMARVLGWTPAQRDREVENYRLRVEAERAS
QEQQTDETADATRLGAPDVIPLS
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgacagtgctctcacctgagcgtcgggacgccgccctggccgccctcgcagcggccgag
gtcgacgtgctggtcatcggtgggggagtggtcggggcgggttgcgccctcgacgcggtc
acgcgggggctctccgtgggactcgtcgaggcgcgcgacttcgcctcgggcacgtccagc
cggtccagcaaactgatccacggcggcctgcgctatctggagatgctcgacttcgggctg
gtccacgaggcgctgcgggaacgcgggctgatcctgtcccggctcgccccgcacctggcc
cgcccggtccggttcctgtacccgctgcagcaccgcggctgggagcggctgtacaccggg
gccggtgtcgccctgtacgacacgatggcctggtcgggcagcctgccgaaccaccggcac
ctgacccggcgcggtgcgctgcgggcctgcccggcgctgcgcaaggagtcgctggtcggg
gcgctgcagtactacgacgcgcaggtcgacgacgcccggcacacgatgttcctggcccgc
accgcggcggcgtacggcgcgcacgtcgccaaccgggtcgaggtcgtcggattcctgcgc
gagggcgaacgcgtcaccggggtgaccgttcgtgacctggaatacgaccgcaccttcgag
atccgcgcccagcaggtgatcaacgcgaccggggtgtggaccgacgagacccagtcgctc
gtgggtgagcgcggccagttccacgtgcgggcgtcgaaggggatccacctcgtcgtaccg
cgggaccggatccagtcgaccaccgggctcatcctgcggacggccagcagcgtgctgttc
gtgatcccgtgggggcggcactggatcgtcggcaccaccgacaccgactgggcgctggac
aaggcgcacccggcggcgtccgcgaaggacatcgactacctgctcaccgaggtcaacaag
gtgctggcccggccgttggaacgggccgacgtgcaaggggtgtacgccggattgcggccg
ctgctctccggcgaatccgagtcgacgtcgaagctgtcccgggaacacatggtgggcagc
ccggtgccggggctggtcgtggtggccggcggaaaatacacgacataccgtgtcatggcg
aaggacgcggtggatgcctgcgccttcaacctgaaccggtccgtcgcccgctgctgcacc
gaccggatcccgctgctcggcgccgaaggctatccggcactgtggaaccggcgcggcctg
atcgccgccggatccggcttgcacatcgcccgtgtcgaacacctgctcggccgatacgga
tcattgatccacgacctgctcgcgctgatcgaggacgacccgacgctgggccggccactg
accggtgcggacgattacctgcgagccgaagtcgtctacgccgcggccgccgagggtgcc
cgccacctggtcgacgtcctcacccgccgcacccgcatctcgatcgagaccttcgaccgg
ggcacgtcctcggcggccgaagccgccgaactgatggcccgcgtgctcggctggaccccc
gcccaacgcgaccgcgaggtggagaactaccgcctgcgcgtcgaagccgaacgcgcctcc
caggaacaacagaccgacgaaaccgccgacgccacccgcctcggcgcccctgacgtgatc
cccctttcctga

DBGET integrated database retrieval system