KEGG   Actinoplanes sp. SE50: ACWT_5497Help
Entry
ACWT_5497         CDS       T05392                                 

Definition
(GenBank) Aquaporin-4
  KO
K02440  glycerol uptake facilitator protein
Organism
acts  Actinoplanes sp. SE50
Brite
KEGG Orthology (KO) [BR:acts00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acts02000]
    ACWT_5497
Transporters [BR:acts02000]
 Other Transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    ACWT_5497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-ProteinID: ATO84912
LinkDB All DBs
Position
complement(6154946..6155782)
Genome map
AA seq 278 aa AA seqDB search
MAARLKVPGLLGELLAEFAGTLILILFGCGVVAQVVAAGIGDHDSIAWAWGLGVTLGVYV
AARISGAHLNPAVTIALAVFKGFSWRKVAPYALAQFLGAFVAALLVRWNYTEVLNAKDPG
LTIKTQGVFSTLPGNGSLPVGHWGAFRDQIIGTAILLFVILALTDMANTAPGANLGPFVV
GLLVVAIGMAWGTDAGYAINPARDFGPRLASFFTGYSTAFRDQTGYLYFWIPIVAPIIGG
VLGAGLYQYLIGRFLPTDEPQEVGEIPTARESLEANRG
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggccgcacgactcaaagttcccggactgctcggtgagcttctcgcggagttcgccggc
acgttgattctgatcctgttcggctgcggggtggtggcccaggtggtggccgccggcatc
ggtgaccacgacagcatcgcctgggcctggggcctgggcgtcaccctcggcgtgtacgtg
gcggcgcggatcagcggcgcccatctcaacccggcggtgaccatcgcgctcgccgtcttc
aagggcttctcctggcgcaaggtggccccgtacgcactggcccagttcctcggcgcgttc
gtcgccgcgctgctggtgcgctggaactacaccgaggtgctcaacgccaaggaccccggg
ctgaccatcaagacccagggtgtcttctccacgctgcccggcaacggcagcctgccggtc
gggcactggggcgcgttccgtgaccagatcatcggcaccgcgatcctgctgttcgtcatc
ctcgcgctgaccgacatggccaacaccgcgcccggtgcgaacctgggaccgttcgtggtc
ggcctgctggtggtcgcgatcgggatggcctggggcaccgacgccggatacgcgatcaac
ccggcccgcgacttcgggccgcgcctggcgagtttcttcaccgggtactcgaccgcgttc
cgagatcagacaggctatctctacttctggataccgatcgtcgccccgatcatcggtggt
gtgctgggcgccggtctgtaccagtatctgatcggacgattcctgccgacggacgagccc
caggaggtgggcgagatcccgacggcgcgtgagagcttggaggcgaaccgtggctga

DBGET integrated database retrieval system