KEGG   Actinoplanes sp. SE50: ACWT_5790Help
Entry
ACWT_5790         CDS       T05392                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
acts  Actinoplanes sp. SE50
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ATO85205
LinkDB All DBs
Position
6439553..6440596
Genome map
AA seq 347 aa AA seqDB search
MLHWPVVPVGTASLRALPEPGATPVIYEMKWDGFRTIIWRNADGVRVQSRHGTDLTAYFP
DLVGPLTAALPPRAVLDGELLVWDPDRGRCSFGLLQRRLVAGRRIAEVSRKHPAHLVAFD
LLRDGRGTELLDQPLSVRRAKLERMLRTAPPQLVLCPQTAVPAVARGWMQDLGTAGIEGV
VIKKIDERYRPGTRSWTKVRTRDTAEYVVGGVTGTVDHPVTLLLGRYDRTGTLRYTGQTH
PVRPEHRADLAAVLHALVFRGPQAGHPWPIPLPTAWTARFNDRRPLTYTPVEPTAVVEVE
VDTAIDGPFGRARHGARLIRVRMDLRPADITLEQTASGDRVGSAAGR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtgctgcactggccggtcgtccctgtcggcactgcgtcactgcgggcacttcccgaaccg
ggcgccacccctgtgatctacgaaatgaagtgggatggtttccggaccatcatctggcga
aacgctgatggtgtgcgcgtccagtcgcgccacggcacagacctcactgcgtactttcct
gatcttgttggtccgctgaccgcagcattaccgccgagggctgtcctcgacggcgagctc
ctggtctgggatcccgatcgcggccggtgcagcttcgggttgctccaacgccgcctcgtg
gccggccggcggatcgctgaggtatcccgcaaacatcccgctcacctggtcgcctttgac
cttctgcgcgacgggcgcggcaccgagctgctggatcagccgctgtcggtgcgccgggcg
aagctggagcggatgctgcggaccgccccgccgcagctggtgttgtgtccccagactgcg
gtgccggcggtggcacgcggctggatgcaggacctcggtaccgccggaattgaaggcgtc
gtcatcaagaagattgatgaacggtaccgtcccggcacccggtcgtggacgaaggtccgc
actcgggacaccgccgaatacgtggtgggtggggtgaccgggaccgtggatcatccggtg
acccttcttctcgggcgttacgaccggacggggacgctgcggtataccggccaaacgcat
ccggtccggcccgagcatcgcgctgacctcgccgcggtcctgcacgctctggtattccgc
ggcccgcaggccgggcatccgtggccaataccgttgccaacggcatggaccgcccggttc
aacgaccggcggccgttaacctacacgccggtggaaccgacagccgttgtcgaggtcgag
gtcgacacggccatcgacgggccgttcggccgagcccgacacggggcgcgcctgatcagg
gtccggatggatctgcgcccagctgacatcaccctcgaacagaccgccagcggtgatcgg
gttggatccgcggccggacggtga

DBGET integrated database retrieval system