KEGG   Actinoplanes sp. SE50: ACWT_6597Help
Entry
ACWT_6597         CDS       T05392                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
acts  Actinoplanes sp. SE50
Pathway
acts00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:acts00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    ACWT_6597
Enzymes [BR:acts01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     ACWT_6597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C DUF4434 Glyco_hydro_14 Glyco_hydro_35
Motif
Other DBs
NCBI-ProteinID: ATO86012
LinkDB All DBs
Position
complement(7392449..7394395)
Genome map
AA seq 648 aa AA seqDB search
MKSIVLGCDYNPEQWTPEVWREDVALMREAGVKLVAVNIFGWSHLEPSPGRYEFDALDEV
IGLLHAGGIRLNLGTGTASPPPWLTTLHPEALPVAADGTTRFPGGRQAWCPSSPAFRERA
FALVEQVADRYGDHPALDLWHVSNELGCHNALCYCEASAAAFRSWLRRRYGRIETLNDAW
GTAFWSQRYGDWAEIQPPRLALSVRNPAQIVDFHRFSSDELLDYYRSEAAILRARSAAPV
TTNFMVTAHIRNLDYWSWAPEMDVVANDHYLDHRLGDPTAELSFAADLTRGLAGGKPWML
MEQAAGAVNWQPHNLTKAPGEMLRNTLTHVARGADSVCFFQWRASAQGAEKFHSALLPHA
GTDTVAWREVLRLSDTLGRLGEVAGTTVRADVALLFSWDSWWAAEGEARPSQAVEYLDQV
HAAHRALRDLGVTCDVVAPGAELTSYKVVVVPCLYMVDDLAAVRIADFVAAGGKLLVTFF
SGIVDERDRIRLGGYPGAFRDVLGVRVEEFAPLKPGDEVRLSNGATATLWTERLRVTTAE
PVASYLDGPLLGVPAVTRNAFGAGTAWYAATALDAGALRDLLREITGVTAEKPKNTEVVR
RGHYLFVINHGAEPIEYPVTGFDLVTEKATDGLLRVEGGGVAVVREES
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcatcgtgctgggttgtgactacaatccggagcagtggacccccgaggtctgg
cgggaggacgtcgcgctgatgcgcgaggccggcgtcaagctggtggcggtcaacatcttc
ggctggtcgcacctcgagccgtccccgggccgctacgagttcgacgccctggacgaggtc
atcggcctgctgcacgccggcgggatcaggctgaacctgggcaccggcaccgcctccccg
ccgccgtggctgaccaccctgcacccggaggcgctgccggtcgcggccgacggcaccacc
cgcttcccgggtggccgacaggcgtggtgccccagctccccggccttccgggagcgggcg
ttcgccctggtcgagcaggtcgccgaccgctacggcgaccacccggcgctggacctctgg
cacgtctcgaacgagctgggctgccacaacgcgctctgctactgcgaggccagcgctgcg
gcgttccggtcctggctgcggcgccggtacggcaggatcgaaaccctgaacgacgcatgg
ggcaccgccttctggagtcagcggtacggcgactgggccgagatccagccgccccgcctg
gccctgtcggtccgcaacccggcgcagatcgtcgacttccaccggttcagctccgacgag
ctgctcgactactaccggagtgaggcggccatcctgcgggcccgctcggccgccccggtc
acgacgaacttcatggtcaccgcgcacatccgcaacctggactactggtcctgggcgccg
gagatggacgtggtggccaacgaccactacctggatcaccggctgggtgatccgacggcc
gagttgtccttcgccgccgatctgacccgtgggctggccggcgggaagccgtggatgctg
atggagcaggcggccggcgcggtcaactggcagccacacaacctgaccaaggcgccgggc
gagatgctgcggaacacgctgacccatgtggcgcggggcgccgactcggtctgcttcttc
cagtggcgggcttccgcgcagggtgccgagaagttccattcggcgctgctgccgcacgcc
ggcacggacaccgtggcgtggcgcgaggtgctgcggctctccgacacgctgggccggctg
ggtgaggtggccggcacgaccgtgcgagcggacgtcgcgctgctgttcagctgggattcg
tggtgggcggcggagggggaggcccggccgtcgcaggcggtggagtatctggaccaggtg
cacgcggcgcaccgggcgctgcgcgacctcggggtcacctgtgacgtggtggcgcccggg
gcggagctcacgtcgtacaaagtcgtcgttgttccctgcctctacatggtcgacgatctg
gcggcggtgcggatcgccgatttcgtcgcggccggcgggaagctgctggtgacgttcttc
agcggcatcgtcgatgagcgtgaccggattcggctgggcggctacccgggtgcgttccgc
gatgtgctgggtgtgcgggtggaggagttcgcgccgctcaagcccggtgacgaggtgcgg
ctcagcaacggcgcgacggcgacgctctggaccgagcggctgcgggtcacgaccgcggag
ccggtcgccagttacctggacgggccgctgctgggggttccggcggtcacccgcaacgcc
ttcggcgcggggacggcctggtatgccgcgacagcgctcgacgccggcgcgctgcgggac
ctgctgcgcgagatcaccggggtgacggcggagaagccgaagaacaccgaggtggtacgc
cgcggccactacctcttcgtgatcaaccacggcgccgagccgatcgagtacccggtgacc
ggattcgatctcgtcaccgagaaggcgaccgacgggctgctgcgggtcgagggcggcggc
gtcgcggtggtccgggaggaatcatga

DBGET integrated database retrieval system