KEGG   Actinoplanes sp. SE50: ACWT_6940Help
Entry
ACWT_6940         CDS       T05392                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
acts  Actinoplanes sp. SE50
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ATO86355
LinkDB All DBs
Position
7809038..7810105
Genome map
AA seq 355 aa AA seqDB search
MQLPIQHPVKPMLAKPVPEIPPGLIYEPKWDGFRSIIFRDGDEVEIGSRNEKPMTRYFPE
VVEAVLANFPERAVIDGEVIVADTGRNTLDFEALQQRIHPAASRVKLLSEQTPASFVAFD
LLALGDEDLTELPFEQRRERLRQALGQAEAPVYVTPATDDTDTARRWFEEFEGAGLDGLI
AKGRELTYQPDKRVMFKIKHKRTADCVVAGYRVHKSAENRIGSLLLGLYDERGVLASVGV
IGSFPMKVREELFDQMQPLVTGFDGHPWDWAAHQQGERTPRKNEVSRWNAGKDLSFVPLR
PERVVEVRYDYMEGVRFRHTAQFERWRPDREPRTCTYEQLERPVRFDLAEVLTSR
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgccgatccagcatccggtcaagccgatgctcgccaagcccgttccggagatc
ccgcccggcctgatctacgagcccaagtgggacggcttccggtcgatcatcttccgggac
ggcgacgaggtggagatcggcagccgcaacgagaaaccgatgacccggtacttccccgag
gtcgtcgaggcggtcctggccaacttcccggagcgggcggtgatcgacggcgaggtgatc
gtcgccgacaccggtcgcaacaccctcgacttcgaggcactgcagcagcggatccacccc
gccgccagccgggtcaagctgctctcggagcagaccccggccagcttcgtcgccttcgac
ctgctggcgctcggcgacgaggacctcaccgagctgcccttcgagcagcggcgggaacgc
ttgcggcaggcgttgggccaggccgaggcgccggtgtacgtcacgccggccaccgatgac
accgacaccgcgcgccggtggttcgaggagttcgagggcgccgggctggacgggctgatc
gccaagggacgggagctcacctaccagcccgacaagcgggtcatgttcaagatcaagcac
aagcggaccgcggactgcgtggtcgccgggtaccgggtgcacaagtcggcggagaaccgg
atcggctcgctgctgctcggcctctacgacgagcgcggcgtgctggcctcggtcggggtc
atcggctcgttcccgatgaaggtccgcgaggagctgttcgaccagatgcagccgctggtc
accggcttcgacgggcacccctgggactgggccgcccaccagcagggcgaacgcaccccg
cgcaagaacgaggtgagccggtggaacgccggcaaggacctgtcgttcgtcccgctgcgc
ccggaacgggtcgtcgaggtccgctacgactacatggagggcgtccggttccggcacacc
gcgcagttcgagcgctggcggcccgaccgggagccccgcacctgcacgtacgagcagttg
gagcgccccgtccggttcgatctcgccgaggttctcaccagccgctga

DBGET integrated database retrieval system