KEGG   Actinoplanes sp. SE50: ACWT_7204Help
Entry
ACWT_7204         CDS       T05392                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
acts  Actinoplanes sp. SE50
Pathway
acts00473  D-Alanine metabolism
acts00550  Peptidoglycan biosynthesis
acts01100  Metabolic pathways
acts01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:acts00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ACWT_7204
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ACWT_7204
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    ACWT_7204
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:acts01011]
    ACWT_7204
Enzymes [BR:acts01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ACWT_7204
Peptidoglycan biosynthesis and degradation proteins [BR:acts01011]
 Precursor biosynthesis
  Amino acid ligase
   ACWT_7204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 ATP-grasp_3 CPSase_L_D2 ATPgrasp_ST TTL
Motif
Other DBs
NCBI-ProteinID: ATO86619
LinkDB All DBs
Position
complement(8098084..8099187)
Genome map
AA seq 367 aa AA seqDB search
MTTPRKTRVAIVFGGRSTEHAISCVSAGAILGALDPDQYETVPVGITREGRWVLAAGDPA
QLAIAGERLPEITAGSGSAVVLPADPTAAELIVRDPADGVAELAELAGVDVVFPVLHGAY
GEDGTIQGMLEMAGIPYVGANVFASAAAMDKEFTKKLAAAEGIPVGPYAVLRAGMSLTEA
DKERLGLPVFVKPSRAGSSTGITKVTDWADLDAAITKAREIDPKVLVEAAIVGSEIECGV
LEGEFGGPPQASLLAEIHMDGADWYDFATKYLVGSRYTIPAALPHDLTRQVQEYALRTFT
ALDCAGLARVDFFVTAAGEVYLNEINTMPGMTPTSMFPQMWAATGLEYPKVVDRLIRTAL
RRGTGLH
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaccccccggaagacccgtgtcgcgatcgtgttcggcggacgcagcactgagcac
gccatttcctgcgtgagcgcgggtgccatcctgggtgcgctcgaccccgatcagtacgag
accgtcccggtcggaatcacccgggagggtcgctgggtgctcgccgccggagatccggcg
cagctcgccatcgccggtgagcggctgcccgagatcaccgccggctcgggcagcgcggtg
gtgcttcccgccgacccgaccgccgccgagctgatcgtgcgcgacccggccgacggcgtc
gccgagctcgccgagctcgccggggtcgatgtggtcttcccggtgctgcacggggcgtac
ggggaggacggcaccatccagggcatgctggagatggccgggattccgtacgtgggggcc
aacgtcttcgcctcggccgccgccatggacaaggagttcaccaagaagctggccgccgcc
gagggcatcccggtcgggccgtacgcggtgctccgggccggcatgtcgctcaccgaggcg
gacaaggagcggctcgggctgccggtgttcgtgaagccgtcgcgggccgggtcgtcgacc
ggcatcaccaaggtcaccgactgggccgacctggacgcggcgatcaccaaggcccgtgag
atcgaccccaaggtgctcgtcgaggcggcgatcgtcggcagcgagatcgagtgcggcgtg
ctggagggtgagttcggcgggccgccgcaggcgtcgctgctcgccgagatccacatggac
ggcgccgactggtacgacttcgcgacgaaatacctggtgggaagccgctacacgatcccg
gccgcgctgccgcacgatctgacccggcaggtccaggagtacgcgctgcgcaccttcacc
gcgctggactgcgccggcctggcccgggtcgacttcttcgtcaccgcggccggcgaggtc
tacctcaacgagatcaacacgatgccggggatgacgccgacctcgatgttcccgcagatg
tgggcggccaccggcctggagtacccgaaggtggtcgaccggctgatccgcaccgccctg
cgacgcggcaccggcctgcactaa

DBGET integrated database retrieval system