KEGG   Actinoplanes sp. SE50: ACWT_7423Help
Entry
ACWT_7423         CDS       T05392                                 

Definition
(GenBank) superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
acts  Actinoplanes sp. SE50
Brite
KEGG Orthology (KO) [BR:acts00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ACWT_7423
Enzymes [BR:acts01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ACWT_7423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni Phage_clamp_A
Motif
Other DBs
NCBI-ProteinID: ATO86838
LinkDB All DBs
Position
8352354..8352758
Genome map
AA seq 134 aa AA seqDB search
MRLPRFLMPRTVVSAHCDLPCGVYDPAQARIEAESIKAIAEKYAANTDPEFRTRAILIKE
QRAELVKHHLWVLWTDYFKAPHFEKYPNLHQLFNEATKLAGASGAKGSVDVAVADQLLGK
IEEISKIFWETKQA
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgcgacttccgcgtttcctgatgccgcgcaccgtggtcagcgcgcactgcgacctgccc
tgcggcgtctacgacccggcccaggcccggatcgaggccgagtcgatcaaggccatcgcc
gagaagtacgcggcgaacacggaccccgagttccgcacccgggccatcctgatcaaggag
cagcgcgccgagctggtcaagcaccacctctgggtgctgtggaccgactacttcaaggcc
ccgcacttcgagaagtacccgaacctgcaccagctcttcaacgaggccaccaagctcgcc
ggcgcgtccggcgccaagggctcggtcgacgtcgcggtcgccgaccagctgctcggcaag
atcgaggagatctccaagattttctgggagaccaagcaggcctga

DBGET integrated database retrieval system