KEGG   Actinoplanes sp. SE50: ACWT_8063Help
Entry
ACWT_8063         CDS       T05392                                 

Definition
(GenBank) xylose isomerase
Organism
acts  Actinoplanes sp. SE50
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ATO87478
LinkDB All DBs
Position
complement(9023090..9023896)
Genome map
AA seq 268 aa AA seqDB search
MSRFSFNQITARSWDLPDLVAGCVEAGVGQVALWREPVAEYGLERSAALVREAGLTVTTL
CRSGFFQEPDWFDDNRRAIDEAAALGTTVLVLVSGGLPDGSRDLAGARRHVGDAIARLVP
HAAAAGVTLAIEPLHPMYAADRCVINTWDQAVAIAEQHPAGQVGVAVDTYHLWWDDTVLD
KIAEAGERIAIYQLADWITPLPAGVLTGRGLPGDGCVDMRAFHEAVDRAGYAGPIEVEVM
NADLWERPGREVLWAALTAYESVFQRSL
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagccggttctcgttcaatcagatcaccgcccggtcgtgggacctgccggacctggtc
gccgggtgcgtcgaggccggcgtcggacaggtcgcgctgtggcgcgagccggtcgccgaa
tacgggttggaacgctccgcggccctggtccgcgaggccggattgaccgtcaccacgctc
tgccgcagcggcttcttccaggagccggactggttcgacgacaaccgccgggcgatcgac
gaggccgccgcgctcggcaccaccgtgctggtcctggtctccggcggcctgccggacgga
tcccgggacctggccggggcgcgccggcacgtgggcgacgcgatcgcccggctggtcccg
cacgcggccgcggccggggtgaccctggcgatcgagccgctgcacccgatgtacgccgcc
gaccgctgcgtgatcaacacctgggaccaggccgtggcgatcgccgaacagcaccccgcc
gggcaggtcggggtcgccgtcgacacgtaccacctctggtgggacgacacggtgctggac
aagatcgcggaggccggtgagcggatcgcgatctaccagctggccgactggatcacaccg
ctgccggccggggtgctgaccggccgggggctgcccggagacggctgcgtggacatgcgg
gccttccacgaggcggtggacagggccggatatgccgggccgatcgaggtcgaggtgatg
aacgccgacctctgggaacggccggggcgagaggtgctctgggcggcgctcacggcgtac
gaaagtgtgtttcagaggtccttgtga

DBGET integrated database retrieval system