KEGG   Actinotignum sp. 313: DDD63_04410Help
Entry
DDD63_04410       CDS       T05430                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
actt  Actinotignum sp. 313
Pathway
actt00010  Glycolysis / Gluconeogenesis
actt00030  Pentose phosphate pathway
actt00051  Fructose and mannose metabolism
actt00052  Galactose metabolism
actt00680  Methane metabolism
actt01100  Metabolic pathways
actt01110  Biosynthesis of secondary metabolites
actt01120  Microbial metabolism in diverse environments
actt01130  Biosynthesis of antibiotics
actt01200  Carbon metabolism
actt01230  Biosynthesis of amino acids
actt03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:actt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DDD63_04410
   00030 Pentose phosphate pathway
    DDD63_04410
   00051 Fructose and mannose metabolism
    DDD63_04410
   00052 Galactose metabolism
    DDD63_04410
  09102 Energy metabolism
   00680 Methane metabolism
    DDD63_04410
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    DDD63_04410
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:actt01009]
    DDD63_04410
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:actt03019]
    DDD63_04410
Enzymes [BR:actt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     DDD63_04410
Protein phosphatases and associated proteins [BR:actt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     DDD63_04410
Messenger RNA biogenesis [BR:actt03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     DDD63_04410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AWE42121
LinkDB All DBs
Position
complement(1021383..1023644)
Genome map
AA seq 753 aa AA seqDB search
MSSNADSRQRIAVLTSGGDAPGMNAVVRAVVRTTIHAGAVPYAIYEGWKGAVEGGDLIRE
TGWSDVSNILNQGGTRIGTARSEAFRTREGMRAAVRNLAALGIDRVVAIGGDGTLTGAAE
LRSLWPELLAELVERGEITPEVAAAHPRLHLVGVVGSIDNDLVGSDMTVGTDSALHRIVD
AIDAISSTAASHQRTFIIEVMGRRCGYLALMSAIAGGCDYVFIPELPPAPGWEEQLCEKL
RTGRAAGRRDSIIVVAEGAQDRAGLPITATQVRDVLADGLGEEARITALGHVQRGGTPSA
YDRWMPTLLGYTAALEAVRADDEAEPCIIATNRNRITRRPLHQAVADTRAVKGYLKDGDY
DAAVDSRGVGYRQMIDIFETISSPVPTRHGAGSGARVAIMHAGGLAPGMNTAARAAVRLG
VDRGFTMLGVNGGFPGLIDGDVHELTWGDVDSWVGAGGAALGTRRTGPAVEQYYALGRAI
EEHRIDAILMIGGFAGYESIWRLLRERDRFPAFNIPFVCVPASIDNNLPGSELSIGADTA
LNNNTEVLDRIKQSASASRRCFVAETMGRKCGFLALMSGISSGAEQVYLYERGITLAQLS
ADTQRMVESFKAGRELYLVVRCEQASEYYTTDLLTRVFQEEGHGLFDVRPAILGHMQQGG
NPSPFDRTLAVRLTTYAIDELERQLHTGRHRGAHVGMADGTVQTYPLSHMDEQIDMATRL
PYDPWWLNLYSVLYTVADKNYTEPLQPLDIFEG
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
gtgagctcgaatgcagatagtcgccaaagaattgccgtcctgacatcaggcggtgacgca
ccggggatgaatgcagttgtgcgcgccgtcgtgcgcacaactatccacgccggtgccgtt
ccctatgccatctatgaagggtggaaaggcgccgtcgaaggcggcgatctcatccgcgaa
accggttggtctgatgtctccaacattctcaaccagggcgggacgcgtattggcaccgct
cgcagcgaagcgttccgtactcgcgagggtatgcgagctgcggtccgaaatctcgccgca
ctcggcatagaccgcgtcgttgccattggtggagacggtacgctcaccggggcggccgaa
ctgcgttccctctggccggaattgctggctgaactcgtggaacgcggcgagattaccccc
gaggtggcagcggcacatccacgcttgcacctagtcggcgtcgtcggttcgattgataac
gatctggtcggatcggatatgaccgttggaactgactccgcattacatcgcattgtcgac
gcgattgacgctatttcctccaccgccgcatcacaccagcgtaccttcattatcgaggtg
atgggcaggcgctgcggttatctggcgctgatgagcgccattgccggcgggtgtgactac
gttttcatcccggaacttcctcccgcgccgggatgggaagagcaattgtgcgagaaactg
cgcaccgggcgggcggcgggacgccgcgactccattattgtggttgccgaaggcgcccag
gaccgtgccggtctgcccattaccgccacgcaggtgcgcgacgtcttggcggacgggctt
ggcgaagaggcgcgtatcaccgccctcggccacgtgcaacgcggcggcacgccctcggcc
tatgaccggtggatgccgaccctgctgggatacacagcggctctggaagctgtccgcgcc
gacgacgaggccgagccgtgcatcatcgcaacaaaccgcaaccgcatcacacgccgacct
ctacaccaagccgtcgccgatacacgcgcggtgaagggctacctgaaggacggcgattac
gatgcggcggtcgactcacgtggcgtcggctaccggcaaatgattgatatcttcgagacg
atatcctccccggtgccaacacggcacggagccgggagcggcgctcgcgttgccatcatg
catgccggcggtctcgctcccggtatgaatactgcggcgcgagctgcggtgagactgggc
gtcgaccgtggcttcaccatgctgggtgttaacggtggcttccccgggctgatcgacggc
gacgtgcatgaactgacctggggcgatgtcgattcttgggtgggcgcgggaggcgcggcg
ctgggaacgcggcgcaccggacccgctgtagaacagtactacgcactcggtcgcgccatc
gaagagcatcgcatcgacgccatcttaatgatcggaggcttcgccggctacgagtccatc
tggcgcctgctgcgcgaacgtgaccgcttcccggccttcaacattcccttcgtctgcgtt
ccagcctccattgataacaatctgcccggctccgagctgtcaatcggcgccgatacggcc
ctgaataacaatacggaagtgctcgaccgtatcaagcagtccgcaagtgcctcccgccgc
tgcttcgtcgccgaaacaatggggcgcaagtgcgggttcctcgcgcttatgagcggtatc
tcctccggggcggagcaggtgtatttgtacgagcgtggcattacgttggcgcaactctcc
gcggatacgcagcgcatggtcgaaagcttcaaggcgggccgcgagctgtacctggtggtc
cgatgcgagcaggcctcggagtattacaccaccgatctactcactcgtgtcttccaggaa
gaggggcatggcctgttcgacgtgcggccagccatcctcggtcatatgcagcagggcgga
aatccctcaccttttgatcggacactcgccgtgcggctaacaacctacgccattgatgag
ctggagcggcaattgcacaccgggcgccaccgcggggctcacgtgggtatggcggacggg
accgtgcagacctatcctctctcgcatatggatgaacagatcgatatggccactcgcctc
ccctatgacccgtggtggctgaacctatattcggttctgtacacagtggccgacaagaac
tacaccgagccgctgcaaccgctggacatcttcgagggttaa

DBGET integrated database retrieval system