KEGG   Actinobaculum sp. 313: DDD63_07125Help
Entry
DDD63_07125       CDS       T05430                                 

Gene name
aceE
Definition
(GenBank) pyruvate dehydrogenase (acetyl-transferring), homodimeric type
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Organism
actt  Actinobaculum sp. 313
Pathway
actt00010  Glycolysis / Gluconeogenesis
actt00020  Citrate cycle (TCA cycle)
actt00620  Pyruvate metabolism
actt01100  Metabolic pathways
actt01110  Biosynthesis of secondary metabolites
actt01120  Microbial metabolism in diverse environments
actt01130  Biosynthesis of antibiotics
actt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:actt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DDD63_07125 (aceE)
   00020 Citrate cycle (TCA cycle)
    DDD63_07125 (aceE)
   00620 Pyruvate metabolism
    DDD63_07125 (aceE)
Enzymes [BR:actt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     DDD63_07125 (aceE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDH_E1_M Transketolase_N Transketolase_C
Motif
Other DBs
NCBI-ProteinID: AWE42562
LinkDB All DBs
Position
1641274..1644009
Genome map
AA seq 911 aa AA seqDB search
MSQQTPPLINGQLSQVPDIDPEETSEWVDSIDNLIESGGALRARYILTSLEQRARQKGVN
IPPNLVTPYINTIPVEDEPFYPGDETLERQFRRWVRWNAAVMVTRAQRPGVAVGGHISSF
AAQATLYEVGFNNFFRGKDHLGGGDQVYFQGHSSPGNYARAFLEGRLREEDLDSFRQQVS
RPSGGRGLPSYPHPHQMADFWEFPTVSLGIGPLNAIYQAWFNRYLDERGIKDTKNQHVWA
FMGDGEMDEAESRGLLQTASSQGLDNLTFVINCNLQRLDGPVRGNGKIIQELEAFFKGAG
WNVIKVIWGREWDRLLQADKDGALVNLMNETLDGDYQSFKAHDGAYVRNEFFGRDPRTKA
MVADWSDEQIWSLKRGGHDYRKVYAAYKAALEHTGRPTVILAHTIKGYALGTNFAGRNST
HQMKKLNSADLKLLRDTLHLDIDDTQLEDPYTAPYYKPEPDHPAMQYMLDKRAALGGFLP
ERRVFSQGVTMPKKKHFDTLKPGSGKQKVATTMALVRLVKDLIKDKDFGYRIVPIIPDEA
RTFGLEALFPSAKIFNTLGQQYTAVDQDMLLSYKESEKGQLLHTGISEAGSTAAFTAVGT
SYATHGTPMVPFYIYYSMFGFQRTGDLFWAAADQMARGFVVGATAGRTTLTGEGLQHLDG
HSPILASTNPSAVIYDPAYAYEIAHIFRDGLVRMYGDGSDGRDPNVFYYLTVYNEPIHQP
AEPENVDAEGILKGIYLLDGVEGDGPRVQLLASGVGVPWAREARRLLAEDWGVRAAVWSV
TSWYELRKDGLAADQHNFLHPEEPIRTAYVTEKLQGAEGPFVATSDYDHQVQDAIRPWIP
GAYYTLGANGFGFSDTRSAARRNFKIDAASMVVRALQGLADQGAIDRSVVKQAIDRYDLF
NPNAAEPVRDL
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcagactccacccctcattaacggtcagctcagccaggtgcccgatatcgac
ccagaagaaaccagtgagtgggtcgattcaatcgataacctcatcgagtcaggaggcgcc
ttacgcgcccgttacatcctgaccagcctggagcagcgagcacgccagaagggtgtgaac
atcccgccaaatctcgtcactccgtatatcaacaccatcccggtggaagacgaaccgttc
tatcccggtgacgagacactcgagcggcagtttcgacgctgggtgcggtggaacgccgca
gtgatggtgaccagggcgcagcgcccgggcgtggcagtcggcggtcacatttcgtccttc
gcggcgcaggcaacgctgtacgaagtcggtttcaataacttcttccgcggcaaagatcac
ctgggcggtggcgaccaggtgtacttccagggtcattcctctcccggcaactacgcgcgc
gccttcctggaaggtcggctacgtgaggaagatctcgactcgttccggcagcaggtgtca
cggccttccggtgggcgtggcctgccctcctatccgcatccgcaccagatggcggacttc
tgggagttcccgaccgtttccttgggtattggtccgctcaatgccatctaccaggcatgg
ttcaaccgctacctcgatgagcgcgggattaaggacaccaagaaccagcacgtgtgggcc
ttcatgggcgacggcgaaatggacgaggcagaatcgcgtggactactgcaaaccgcctct
tcacagggcctcgacaatctcaccttcgtgatcaactgcaacctccagcgcctggacggc
ccggtgcgcggtaacggcaagatcattcaggaactcgaagccttcttcaagggagccggc
tggaacgtcatcaaggtaatctggggtcgcgagtgggatcggctcctacaagccgataag
gatggcgcacttgtcaatctgatgaacgagacgctcgacggcgattatcagagtttcaaa
gcgcatgacggtgcctatgtacgcaacgaattctttgggcgtgatccccgcaccaaggcg
atggtggccgactggagcgacgagcagatctggtcgcttaagcgcggcggccacgactac
cgcaaggtctatgcggcttacaaagcggctttggagcataccggacgccccaccgtgatt
ctcgcgcacacgatcaagggctacgcgctgggaaccaacttcgccggccgaaattcaacg
caccagatgaaaaaactgaattcagcggacctcaaactgctacgcgacacgctacatctc
gacatcgacgacacccagttggaggatccttacacggctccctattacaagccggagcca
gatcatcccgcaatgcaatacatgctggacaagcgcgccgcacttggaggcttcttgccg
gaacgacgcgtcttttctcaaggcgtcaccatgcccaagaagaagcacttcgataccttg
aaacccggctctggaaaacagaaagtagccaccacgatggcgctggttcgcttggtgaag
gacctcatcaaagataaagacttcggctaccgcatagtgccaattatcccggatgaagcc
cgcaccttcggattggaggcactgttcccctcagcgaagatcttcaacacgcttggccag
cagtacactgcggtggatcaagacatgctgctgtcctacaaggagtctgagaagggccag
ttgctgcacaccggtatctcggaagccggctcgactgcggccttcacggctgtcggtacc
tcgtatgccacccatggcacgccaatggtccccttctatatctactactccatgtttggt
ttccagcgcaccggagacctcttctgggcggctgccgaccagatggcgcgcggcttcgtc
gtcggtgctaccgctggacgtacgacgctcacgggcgaaggactgcagcatcttgacggt
cattccccgatcctcgcttccaccaacccgagtgcagtgatctatgacccggcctatgcc
tacgagatcgcgcatatcttccgtgacggcttggtgcggatgtacggcgacggctctgac
ggacgcgatccgaatgtcttttactatctgaccgtgtacaacgaacccattcaccagccc
gcagaaccggagaatgtggatgccgaaggtattcttaagggcatctatctcctcgacggc
gtcgagggcgatgggccgcgcgtgcaactgcttgcctccggcgtaggggtgccgtgggcg
cgcgaggcgcggcgcttactggcagaggactggggcgtgcgagcggccgtttggtcggtg
acatcctggtatgagttgcgcaaggatgggctcgccgccgatcagcacaacttcctgcac
ccggaggagccgatacgcactgcatatgtgacggagaagctacagggcgccgaggggccc
tttgtcgccacctccgactatgatcatcaggtacaggacgcaatccgcccctggatcccc
ggcgcatactacacactgggcgcaaatgggttcgggttctcagatacccgctcagccgca
cggcgcaatttcaagatcgatgccgcatccatggtggtgcgcgctctgcagggcctcgca
gaccaaggggcaattgatcgcagcgtggtcaagcaggcaattgaccgctacgatctgttc
aaccccaatgcagcggagcctgtccgcgatctttag

DBGET integrated database retrieval system