KEGG   Actinobaculum sp. 313: DDD63_10015Help
Entry
DDD63_10015       CDS       T05430                                 

Definition
(GenBank) xylose isomerase
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
actt  Actinobaculum sp. 313
Pathway
actt00040  Pentose and glucuronate interconversions
actt00051  Fructose and mannose metabolism
actt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:actt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    DDD63_10015
   00051 Fructose and mannose metabolism
    DDD63_10015
Enzymes [BR:actt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     DDD63_10015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AWE43016
UniProt: A0A2S1I523
LinkDB All DBs
Position
2325842..2326831
Genome map
AA seq 329 aa AA seqDB search
MTQYPEFGAGLWHFATYVDRYAVDRYGDPRGTLEQIELAGKVKDLSWVDINYPFSPGVTV
DEVKDALKANNLKCVGITPEIYLRDHVRGAFTNPDDAARRRAIDIMQAGADMVRELGARY
VKTWPGQDGWDYPFQVDYHDVWKKSVDAMRELAINNPDLNFVIEYKPREPRNHMIWNNAS
RTILGIQEMGVDNVGVLLDFGHSLFGGETPSDEAQLLIDHGKLFAMDVNDNFRGWDDDLV
VGTVHPIEILEFFYTLKKNNWEGVWQLDEFPFREDVVEAANLGIDFLKAICRTLEVIDMD
AIAQAQAAQDAIAVQRMVQKALFSSMAGE
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacacaatatccagaattcggcgccggcctctggcatttcgccacctatgtagaccgg
tacgccgttgaccgttacggcgacccgcgcggcacacttgagcagatcgagttggcggga
aaggtcaaggacctcagctgggtcgatatcaattaccccttcagcccaggcgttaccgtc
gatgaggtcaaggacgcgctaaaggccaacaatctcaaatgtgtgggcatcaccccggag
atctacctgcgcgatcacgtccggggcgcatttacgaaccccgacgacgccgcccggcgt
cgtgccatcgacatcatgcaggcgggagccgacatggtgcgtgaactcggtgcgcgctac
gtgaagacgtggccaggccaagacggatgggattatcctttccaggtcgactaccacgat
gtgtggaagaagtcggtcgacgccatgcgggagctggccatcaacaatcccgacctcaac
ttcgtcatcgaatacaaaccgcgcgaaccacgtaaccacatgatctggaacaacgcctca
cgcaccatcctcggtattcaggaaatgggcgtggacaatgttggcgttctcctcgatttc
gggcactccctcttcggcggagagacgccgtcagatgaggcacagctgctgatcgaccac
ggcaagctattcgccatggacgtgaacgataacttccgtggctgggatgacgacctggtt
gtcggaacggttcatcccatcgaaatcctggagttcttctacaccttgaagaagaacaac
tgggaaggcgtgtggcagttggacgagttccccttccgcgaagacgtggtggaggccgcc
aacctcggcatcgacttcctcaaggccatttgtcgcacccttgaagtcatcgacatggac
gccatcgcgcaggcgcaggccgcacaggacgccatcgccgtgcagcgcatggtgcaaaag
gcgctcttctcgtccatggcgggtgagtga

DBGET integrated database retrieval system