KEGG   Actinobaculum sp. 313: DDD63_11870Help
Entry
DDD63_11870       CDS       T05430                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
actt  Actinobaculum sp. 313
Pathway
actt00473  D-Alanine metabolism
actt00550  Peptidoglycan biosynthesis
actt01100  Metabolic pathways
actt01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:actt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DDD63_11870
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DDD63_11870
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    DDD63_11870
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:actt01011]
    DDD63_11870
Enzymes [BR:actt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DDD63_11870
Peptidoglycan biosynthesis and degradation proteins [BR:actt01011]
 Precursor biosynthesis
  Amino acid ligase
   DDD63_11870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 ATP-grasp CPSase_L_D2 RimK B12-binding GARS_A DUF5021
Motif
Other DBs
NCBI-ProteinID: AWE43329
LinkDB All DBs
Position
2753594..2754562
Genome map
AA seq 322 aa AA seqDB search
MTQPLTVAILAGGLTHEREVSMHSGRRVAAVLREAGVQVKLLDVDSTLLQRLESMSPDVV
WPLVHGSTGEDGSLQNLLELVGVPYVGSDPMGCRLASDKAVASSILGKAGLQVPDSVDIP
QALFRDVGVNPMLDLLGERFGFPLVVKPSPGGSGLGVTIVESAAQLPRAMVDCFAYGENA
HIEQYISGREVAVAVIDVADEDTHGPQALPAVEIVTDGLYDYDARYNAGRVEYFVPARLS
DDDARTVGGAAETVHSTLGLRDYSRTDIIFDGETPWILDVNVAPGMTETSLFPQAVAAAA
KQEGTTVDSFYLRILETAAKRI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgacccagccattgaccgtcgccatcctcgccggcgggctaacccatgagcgcgaggtc
tccatgcattctgggcgccgtgtggccgccgtactgcgcgaagccggcgtacaggtcaaa
ctgctcgacgtcgacagtacactgctgcaacgtctcgaatcgatgtcacccgatgttgtc
tggccactggtgcatggctccaccggcgaggacggctcattgcaaaacctcctcgagctg
gttggtgttccatacgtgggcagtgacccgatgggctgccgcctggcgtccgacaaggcc
gtggcctcatccattctcggcaaggcagggctgcaggtacccgactcggtggatattccg
caggcgctgttccgggacgtgggtgttaatcccatgctcgatctgcttggagagcgtttc
ggattcccgttggtcgtcaagccgtcaccgggaggatctggactcggggtcaccatcgtc
gagtctgccgcgcagcttccgcgagccatggtggactgcttcgcctacggggagaatgcg
catatcgaacagtacatcagcggccgggaagtggccgtggccgtgatcgacgtcgccgat
gaggatacccatgggccgcaggcgctgcccgccgtcgagattgtgaccgacggtctgtac
gactacgacgcccgttacaacgcgggccgcgtggagtatttcgtaccggcacgtctttcc
gacgacgacgcccggaccgtgggtggcgcggccgagaccgtccattcgacgctcgggttg
cgtgactattcacgcaccgacatcatcttcgatggtgagacaccgtggatcctcgatgtt
aatgttgcgccgggtatgacggagacttcgctgttcccgcaggcagttgccgcggccgcc
aagcaggaggggaccaccgtggacagcttttacctccgcatcctggagacagccgccaag
cgcatttga

DBGET integrated database retrieval system