KEGG   Actinomadura sp. WMMB499: F7P10_04730
Entry
F7P10_04730       CDS       T06213                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
actw  Actinomadura sp. WMMB499
Pathway
actw00250  Alanine, aspartate and glutamate metabolism
actw00410  beta-Alanine metabolism
actw00640  Propanoate metabolism
actw00650  Butanoate metabolism
actw01100  Metabolic pathways
actw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:actw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    F7P10_04730
   00650 Butanoate metabolism
    F7P10_04730
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    F7P10_04730
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    F7P10_04730
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:actw01007]
    F7P10_04730
Enzymes [BR:actw01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     F7P10_04730
Amino acid related enzymes [BR:actw01007]
 Aminotransferase (transaminase)
  Class III
   F7P10_04730
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2
Other DBs
NCBI-ProteinID: QFG20558
UniProt: A0A5J6U1U7
LinkDB
Position
1121569..1122822
AA seq 417 aa
MATLSPLLKQATPVLAERGEGVHLYDAEGRRYLDFTAGIGVTNTGHCHPRVVEAAQKQVG
TLIHGQYTTVMHRPLLRLVEAMGEVLPSGLDSVFFLNSGSEAVEASIRLARHATGRQNIV
VFHGSFHGRTMGAAALTTAGTKFRAGIGPLMPGAVVAPFPQAYRYGWDEDEAVRFALREL
DYVLATTSPAPDTAAFMVEPVLGEGGYIPAPPAFLEGLRERADRHGILLIVDEVQTGYGR
TGKFWGHEHSAMRPDVLITAKGLASGFPLSAIAAPAALMEKAWPGSQGGTYGGNAVSCAA
ALATLEVIRDEDLVANAARLGARLNDGLRKIAADHPVIGDVRGLGLMQAGEFTTAGGEPD
TATATRAHRAAADRGLLLLTCGAHGNVVRLIPPLVVNEAQIDEGLAVWAAAVADATS
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggcgacgctgtcacctctgctgaagcaggcgacccccgtcctggccgagcgcggcgag
ggcgtgcacctctacgacgccgaagggcgccggtacctggacttcaccgcgggcatcggc
gtcaccaacaccggccactgccacccgcgcgtggtcgaggccgcccagaagcaggtcggg
accctgatccacggccagtacacgacggtcatgcaccggccgctgctgcgcctggtcgag
gcgatgggcgaggtcctgccgtccggcctcgactcggtgttcttcctgaactccggcagc
gaggccgtcgaggcgtccatccggctcgcccggcacgccaccggacggcagaacatcgtc
gtcttccacggctcgttccacggccgcaccatgggcgccgcggcgctcaccaccgccggg
acgaagttccgcgccggcatcggcccgctgatgcccggagcggtcgtcgccccgttcccg
caggcctaccggtacgggtgggacgaggacgaggccgtccggttcgcgctccgcgagctc
gactacgtcctcgcgacgacgagccccgcgcccgacaccgccgcgttcatggtcgagccg
gtgctcggcgagggcggctacatcccggcgccgccggcgttcctcgaggggctccgcgag
cgcgccgaccggcacggcatcctgctgatcgtcgacgaggtccagaccgggtacgggcgc
accggcaagttctggggccacgagcacagcgccatgcgccccgacgtcctcatcaccgcg
aagggcctggccagcggcttcccgctgtcggcgatcgccgcgccggcggccctcatggag
aaggcgtggcccggctcgcagggcggcacctacggcggcaacgccgtctcctgcgccgcc
gcgctcgccaccctggaggtcatccgggacgaggacctcgtcgccaacgcggcccgtctc
ggcgcccggctgaacgacggcctccgcaagatcgccgccgaccacccggtcatcggcgac
gtccgcggactcggcctcatgcaggccggcgagttcaccacggccggcggcgagcccgac
accgcgaccgccacccgtgcccaccgcgccgccgccgaccgcggcctcctgctgctcacg
tgcggcgcgcacggcaacgtcgtccgcctcatcccgcccctggtggtgaacgaagcccag
atcgacgagggcctggccgtctgggccgccgccgtcgccgacgcgacgagctga

DBGET integrated database retrieval system