KEGG   Acidithiobacillus caldus SM-1: Atc_0927Help
Entry
Atc_0927          CDS       T01581                                 

Definition
(GenBank) Ribulose bisphosphate carboxylase small chain
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
acu  Acidithiobacillus caldus SM-1
Pathway
acu00630  Glyoxylate and dicarboxylate metabolism
acu00710  Carbon fixation in photosynthetic organisms
acu01100  Metabolic pathways
acu01120  Microbial metabolism in diverse environments
acu01200  Carbon metabolism
Module
acu_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:acu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Atc_0927
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Atc_0927
Enzymes [BR:acu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Atc_0927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small Peptidase_C39_2
Motif
Other DBs
NCBI-ProteinID: AEK57576
UniProt: F9ZLP1
LinkDB All DBs
Position
923897..924229
Genome map
AA seq 110 aa AA seqDB search
MAEVQEYKQVRRYETFSYLPPFSAEQVRAQIQYIIAQGWNPAVEHIEPNRPFTYYWYMWK
LPMFGERNVDAVLAELEACRREYPNHLIRLIGYDNYTQSQGLSFVVYRGS
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagtgcaagaatacaagcaggtccggcggtatgagaccttttcgtacctgccg
cccttttccgcggagcaggtgcgggcccagatccagtacatcatcgcccagggctggaat
ccggcggtggaacacatcgagcccaaccgtccctttacctactactggtacatgtggaag
ctgccgatgttcggcgagcgcaatgtcgatgccgtcctggcggagttggaggcctgccgg
cgcgagtacccgaaccacctgatccgtctcatcggttacgacaattacacccagagtcag
ggtttgtctttcgtcgtctatcgcggttcctga

DBGET integrated database retrieval system