KEGG   Acinetobacter cumulans: C9E88_011765
Entry
C9E88_011765      CDS       T06087                                 

Gene name
tssB
Definition
(GenBank) type VI secretion system contractile sheath small subunit
  KO
K11901  type VI secretion system protein ImpB
Organism
acum  Acinetobacter cumulans
Brite
KEGG Orthology (KO) [BR:acum00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acum02044]
    C9E88_011765 (tssB)
Secretion system [BR:acum02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   C9E88_011765 (tssB)
SSDB
Motif
Pfam: T6SS_VipA DUF29
Other DBs
NCBI-ProteinID: QCO22106
UniProt: A0A3A8G2T3
LinkDB
Position
complement(1827755..1828258)
AA seq 167 aa
MSKRESVQKKLQRIRPPRVQLTYDVEVGDGKEVKELPFVVGVLGDFSAASEVEKTKLKDK
KFINVDLDNIDEVMESLAPRASFQVENTLTEEGGKIGVDLTFTSMADFTPEHIVQNVDPL
RKLVEARERLTDLRNKISNNERLEDLLDDVLKNTDQVRKLSAEVESE
NT seq 504 nt   +upstreamnt  +downstreamnt
atgtcaaagcgtgaaagcgttcaaaaaaaattacaacgtatacgtccgccgcgtgtacag
ctcacttacgatgttgaagtaggtgatggtaaagaagtaaaagaattaccttttgttgtt
ggtgtattaggtgacttttctgcagcttcagaagtggaaaagaccaagctgaaagataaa
aagtttattaatgttgatttagacaatattgatgaagtaatggaatctttagcaccacgt
gcaagctttcaagtcgaaaatacattgactgaagaaggtggcaaaattggtgtagatttg
acctttaccagcatggcagattttactcctgagcatattgtacaaaatgtagacccgctt
cgtaagcttgtggaagcgcgtgagcgtttaactgatttgcgtaataaaatttcaaataat
gaacgacttgaagatctattagatgatgttttaaaaaatacagatcaagtacgtaaatta
agtgcggaggttgaaagtgaataa

DBGET integrated database retrieval system