KEGG   Acinetobacter cumulans: C9E88_014450Help
Entry
C9E88_014450      CDS       T06087                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
acum  Acinetobacter cumulans
Brite
KEGG Orthology (KO) [BR:acum00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C9E88_014450 (ahpF)
Enzymes [BR:acum01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     C9E88_014450 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like DAO FAD_oxidored Thi4 AlaDh_PNT_C K_oxygenase FAD_binding_3 FMO-like Spermine_synth Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: QCO22605
UniProt: A0A4P8DVZ9
LinkDB All DBs
Position
1270327..1271892
Genome map
AA seq 521 aa AA seqDB search
MLDQNTSAQLKTLLERLEGPIEIVATLNGSDKSDKIKELVEEVAALSNLVTARFDGTNKR
APSFGIAKAGEEPRVFFAGLPMGHEFTSLILALLQTSGYAPKVSDEVLATIKGLGIKSDF
DVFVSLSCHNCPDVVQALNLIAIYNPGTTATMIDGAFFQDEVEERKIMAVPMVFQDNNHI
GQGRMTLEEIIAKLDTDSDAKEAAKINEKDAFDVLVIGGGPAGNTSAIYAARKGIKTGIV
AERMGGQVMDTMDIENFTSIQKTQGPKFAAEMEAHVREYGVDIMNLQRVADIKGAEQTAN
GLVEVTLENGAKLESKTVILSTGARWREMNVPGEAEYRTRGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLVEFDTKLRADQVLQDKLNSLPNTTVIKNALSTEVVGD
GKQVTALKYKDRATDVEHTVELAGIFVQIGLLPNTDFLKETAVELSNRGEIVINERNETN
VKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYIIRSGQ
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagatcaaaatacttctgcacaattaaaaactcttcttgaacgccttgaaggtcca
attgaaatcgttgcgactttaaatggctctgacaaatcagacaaaatcaaagaattggtt
gaagaagttgctgcattatcaaacttagtgactgctcgtttcgatggcacaaacaaacgt
gcgcctagcttcggtattgcaaaagcaggtgaagagccgcgtgtattctttgcgggcctt
cctatgggccatgaattcacatcactgatcttggcattgctacaaacttctggttatgca
ccaaaagtatctgacgaagttttggcaacaattaaaggcttaggcattaaatctgacttt
gatgtattcgtatctttaagctgccataactgcccagacgtggttcaagcacttaacttg
atcgcaatctacaacccaggcacaactgcaaccatgattgatggtgcattcttccaagac
gaagttgaagaacgcaaaatcatggcagttccaatggtgttccaagacaacaaccatatt
ggtcaaggccgtatgaccttggaagaaatcattgccaaattagacactgattctgatgcg
aaagaagcagcgaaaatcaatgaaaaagacgcatttgatgttcttgtgattggcggtggc
cctgcaggtaatacttctgcaatctatgctgcacgtaaaggcattaaaacaggtatcgtt
gctgagcgcatgggcggtcaggtgatggatacaatggacatcgaaaacttcacgtctatt
caaaagacccaaggtcctaagtttgcagctgaaatggaagcgcacgttcgtgaatacggc
gtagatatcatgaatctgcaacgtgtagctgacatcaaaggtgctgaacaaacggcaaat
ggtttggttgaagtgactttagaaaacggtgcaaaacttgaatcgaaaactgtcatccta
tctacaggtgcacgttggagagaaatgaatgtaccgggtgaagctgaataccgtacacgc
ggtgtagcgtactgcccacactgtgatggtccattgttcaaaggtaaacgtgttgcagtc
atcggtggcggtaactcaggtgtagaagcagccattgaccttgcaggtattgttgagcat
gtaacacttgttgagtttgatactaagcttcgtgctgaccaagtccttcaagacaagtta
aacagcttaccgaacaccactgtaattaagaatgctttatctacagaagtggttggtgat
ggcaaacaagtgactgcactgaaatacaaagaccgtgcaactgatgttgaacacactgtt
gaactagcaggtatcttcgtacaaatcggtttgttgccaaacactgatttcttaaaagaa
acagccgttgaactttcaaaccgcggtgagattgtgattaacgaacgcaacgaaaccaat
gtgaaaggtgtattcgctgcgggtgactgtacaacagtgccttacaaacaaatcatcatt
gctacaggtgaaggcgcgaaagcatcactttcagcattcgattacattatccgttcaggt
cagtaa

DBGET integrated database retrieval system