KEGG   Athene cunicularia (burrowing owl): 113475961
Entry
113475961         CDS       T05777                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun04010  MAPK signaling pathway
acun04020  Calcium signaling pathway
acun04260  Cardiac muscle contraction
acun04261  Adrenergic signaling in cardiomyocytes
acun04270  Vascular smooth muscle contraction
acun04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:acun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113475961 (CACNA1C)
   04020 Calcium signaling pathway
    113475961 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    113475961 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    113475961 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    113475961 (CACNA1C)
   04270 Vascular smooth muscle contraction
    113475961 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:acun04040]
    113475961 (CACNA1C)
Ion channels [BR:acun04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   113475961 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH CAC1F_C PKD_channel DUF4834
Other DBs
NCBI-GeneID: 113475961
NCBI-ProteinID: XP_026696970
LinkDB
Position
1
AA seq 2174 aa
MNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTASSTQRKRQQYGKQ
KKQGTTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPE
DDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFS
AILEQATKADGGNSIGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLL
HIALLVLFVIIIYAIIGLELFMGKMHKTCYHVQGGLIDTPAEDDPSPCAPQSAHGRQCQN
GTECKAGWEGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSL
VIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDID
PENEDEGMDEEKPRNRSTPDGLPDKKKGKFAWFSHSTETHVSMPTSETESVNTDNVPGAD
IEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIAS
EHYNQPDWLTEVQDTANKVLLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILET
ILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFII
IFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPS
FPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTAS
PEKKQEIEKTAVEEETKEEKIELKSITADGESPPATKINVDDYQPNENEEKSPYPTTEAP
AEEDEEEPEMPVGPRPRPMSELHLKEKAVPMPDASAFFIFSPNNRFRVHCHRIVNDNIFT
NLILFFILLSSISLAAEDPVRHLSFRNQILGNADYVFTSIFTLEIILKMTAYGAFLHKGS
FCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVF
VAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYSCTDSSKQTAAECRGYYITYKDGEVNQ
PMIQPRSWENSKFDFDNVLTAMMALFTVSTFEGWPELLYRSIDSHMEDVGPIYNHRVEIS
IFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYI
PKNQYQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCMFKEAMNILNMLFTGLFT
VEMVLKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNHYFCDAWNTFDALIVVGSI
VDIAITEVNPAEHTQCSSSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIK
SFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATG
EAWQEIMLACLPDKKCDPESEPANSTEADHSCGSSFAVFYFISFYMLCAFLIINLFVAVI
MDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCP
HRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKKIWKR
TSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQFAV
LQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSYY
QSDGRSAFPQTFTTQRPLHINKSGNNQGDTESPSHEKLVDSTFTPSSYSSSGSNANINNA
NNTALCRFPSPPSYPSTVSTVEGHGTPLSPTIHVQEAPWKLPSKRTHYYETLGRSSSRDS
QLAIVCQEEVSQDETYDENLNEDIEYCSEPSLLSTEMLAYQDDENRQLTPPENNKGEDTR
HSPKKGFLCSSALGRRASFHLECLKRQKNQGADVSQKTVLPLHLVHHQALAVAGLSPLLQ
RSHSPTMFSRLCATPPATPCSRGWPQQTIPTLRLDGAESSEKLNSSFPSVHCGSRYPDNT
GCSSPRRARPVSLTVPSQTGGSSRQFHGSAGSLVEAVLISEGLMQFAQDPKFIEVTTQEL
ADACDMTIEEMENAADNILNGNSKQSPNGNLLPFVNCRDPGQDSAGEEEEEVQNPDCRKS
QEELKDSRIYISSL
NT seq 6525 nt   +upstreamnt  +downstreamnt
atgaatgccaatgcagctgcagggcttgccccagagcatatccctactccaggagcagct
ctgtcctggcaagctgcgattgatgctgccagacaagccaaactgatgggtagtgctggc
aatgcaacaatatccacagctagctccacacagagaaaacggcagcagtatgggaaacag
aaaaaacagggtaccaccacagctacacgtcctccccgggcactgctgtgtttaacactg
aaaaatcccattcggagggcatgcatcagcatcgtcgaatggaaaccatttgaaataatt
attttactgactatttttgccaattgtgtggccttagctatctatatcccctttccagaa
gatgattccaatgccaccaattccaatctggaacgagtggagtatctctttctcataatt
tttacagtggaagcatttttaaaagtaatagcatatggacttctctttcaccccaacgct
tacctccgcaatggctggaatttactagattttataattgtggtagtagggctttttagt
gcaattttagaacaagcaaccaaagcagatggggggaattcaataggaggaaaaggtgcc
ggattcgatgttaaagcactgagggctttccgagtattacgtccgttaaggctggtatct
ggagttcctagcctccaggtggttctaaattcaattatcaaggccatggtccctttgttg
catattgccctgctggtgctgtttgtcattattatctatgccatcattggactggagtta
ttcatggggaagatgcataagacctgctaccatgtgcaagggggactgatagatacacct
gcagaagatgatccgtctccctgtgccccccagtctgcgcacgggcggcagtgtcagaac
ggcaccgagtgtaaggcaggctgggagggacctaagcacggcattacgaattttgacaat
tttgcttttgccatgctgacagtgtttcagtgcattacgatggagggctggacagatgta
ctgtactggatgcaggacgctatgggctatgagttaccatgggtgtattttgtcagtctg
gtcatctttggatcctttttcgttctaaatctggttcttggtgtgttgagcggggagttt
tccaaagaaagagagaaggctaaggctcggggcgatttccagaagttacgggaaaaacaa
cagctagaggaggatttgaagggatacttagactggataactcaagcagaagatattgac
ccagaaaatgaagatgaaggcatggatgaggagaagcctcgaaacagaagcactccagat
ggcttgcctgataagaagaagggaaagtttgcttggtttagtcactccacagaaacccat
gtgagcatgcccaccagtgagactgagtccgtgaacacagacaacgtccctggagcagat
attgaaggcgaaaactgcggtgctaggctagcgcatcggatctcaaaatcaaagtttagt
cgctactggcgccgatggaatcgattctgcagaagaaagtgccgcgctgctgtcaagtcc
aatgttttctactggttggtgatcttccttgtgtttctcaacacccttaccattgcttct
gaacactacaaccagccagactggctgacagaggtccaagacactgccaataaggtgctg
ctagctcttttcacggcagagatgctgctgaagatgtacagccttggtctccaggcctat
tttgtgtccctcttcaaccgctttgactgtttcattgtgtgtggaggaattctggaaaca
attctggttgagacaaagatcatgtcaccactgggcatttcggtgttgagatgtgttcga
ctcctaaggatatttaaaatcacaagatactggaactccctgagtaaccttgtggcttca
cttctgaattcagtccgctccattgcctccctgttgctccttctcttcctcttcattatc
atcttctcactcctggggatgcagctctttgggggcaagtttaacttcgatgagatgcag
accaggaggagtacatttgacaacttccctcagtccctcctcactgtgtttcagatcctg
actggggaggactggaattcggtgatgtatgatgggatcatggcttatggcggcccctct
tttccaggaatgttggtctgtatttacttcatcatcctcttcatctgtggaaattatatc
ctcctaaatgtatttttggccattgctgtggacaaccttgctgatgctgagagtttaaca
tctgcacagaaagaggaggaagaggaaaaagaaagaaaaaagctagctaggactgctagt
cccgaaaagaaacaggagatagaaaaaacagctgtggaggaggagacaaaggaggagaaa
atcgagctgaaatcaatcaccgctgatggagaatccccgcctgctaccaagatcaatgtg
gatgattatcagcccaatgaaaacgaagaaaagagcccatatcccacaacagaagcgcca
gcagaggaagatgaagaagaacctgagatgcctgtcggccctcggcctcgaccaatgtct
gagctacacctcaaggaaaaggctgtgcccatgcctgatgccagtgcttttttcatcttc
agtcctaacaacaggttccgtgtccactgccatcgaatcgttaatgataacattttcacc
aacctgatcctatttttcatcttgctcagcagcatctccctggcagccgaggaccctgtc
cgacacctctcctttaggaaccaaatcctaggcaatgcagactatgtcttcactagtatc
tttacattagaaattattcttaagatgaccgcatatggggctttcctccataagggctcc
ttttgcagaaactatttcaacatcttagacctgctggtggtcagcgtttctctcatctcc
tttgggatccagtccagtgctatcaatgtggtgaagatcctacgtgttctgagagtcctt
agaccactgagggccatcaacagagccaaaggactaaagcatgtggtccagtgtgtgttt
gttgccatccgaaccatcggaaacattgtgattgtcactactttgctgcagttcatgttt
gcctgcattggagttcagttgtttaagggcaagctgtatagctgcactgacagctccaag
cagacagcagcagaatgcagagggtactacattacgtacaaggatggtgaggtcaaccag
ccaatgatacagccccggagctgggagaacagcaagtttgactttgacaatgtcttgact
gccatgatggccctcttcactgtctcaacctttgaaggctggccagagttgctgtatagg
tccattgattcccacatggaggatgtgggacccatctataatcacagggttgagatctcc
atcttctttattatctacatcatcatcattgctttcttcatgatgaacatcttcgttggt
ttcgtcatcgtcacatttcaggaacaaggagaacaagagtacaagaactgtgagctggac
aaaaaccagcgccagtgtgtagaatatgccctgaaagcccggcccctgcggagatacatc
cctaaaaatcagtaccagtacaaagtttggtatgtggtcaactccacctattttgaatac
ctgatgttcgttctgatcctgctgaacaccatctgcctggccatgcaacactacggtcag
agctgcatgttcaaggaagccatgaatatcctcaacatgctcttcactggcctcttcact
gttgagatggtcctgaaattaatcgccttcaaacccaagggttactttagtgatccttgg
aatgtttttgacttcctcatcgtaattggcagcattatagacgtcattctcagtgaaact
aatcactatttctgtgatgcatggaatacatttgacgccttgattgttgtgggtagcatt
gttgatatagcaatcaccgaggtgaacccagctgaacatacccaatgctcttcctctatg
aatgcagaggaaaactctcgtatctcaatcaccttcttccgactcttccgcgtgatgcgt
cttgtgaagctcctgagccgaggggagggcatccggacactgctttggaccttcatcaag
tccttccaggctctcccctatgtggctcttttaatagtgatgttgttcttcatctacgcc
gtgatcgggatgcaggtgtttggtaaaattgcactgaacgataccacagaaatcaaccgc
aacaacaacttccagaccttcccccaggcagtgctgctgcttttcaggtgtgccactggt
gaggcctggcaggaaatcatgctggcatgtctcccagacaagaagtgcgacccagagtcg
gagccagccaactccaccgaagcagatcactcttgtggcagcagcttcgctgtcttctat
ttcatcagcttctacatgctctgtgccttcctgatcatcaatctttttgtagctgttata
atggataactttgattacctgacacgggactggtccattttaggaccacaccacctggat
gagtttaaaaggatctgggcagagtatgaccctgaagccaagggacggatcaaacacttg
gatgtggtgacattgctccgacggatccagccccccctgggcttcgggaagctctgccct
caccgagtggcttgcaaacgccttgtctccatgaatatgccactgaacagtgatgggact
gtcatgttcaatgccactctctttgcattggtcagaacagcactgaggatcaagacagaa
ggtaacctggagcaagccaacgaagagctgagagcaataattaagaaaatctggaagcgc
accagtatgaagctgctggaccaggtggtgccccctgcaggtgatgatgaggtgaccgtc
ggaaagttctacgccactttcctgattcaggagtatttccggaagttcaaaaaacgtaaa
gaacagggactggtgggcaagccctcccagcgcaacgccctctccttgcagtttgctgtt
ttgcaggctggtctgcgcacacttcacgacattgggccagagatccgacgagcaatttct
ggagacctgacagctgaagaagagctagataaggccatgaaagaagctgtttctgctgcc
tctgaagatgatatcttccggagagccggaggcttgtttggaaaccatgtcagctattac
caaagtgatggcaggagtgcgttcccccagacattcaccacccagcgacctttgcacatc
aacaaatctggcaacaaccagggagataccgagtctccatctcatgagaagctggtggac
tccaccttcactcccagcagctactcatcttcagggtccaatgccaacatcaataatgcc
aacaacactgccctgtgccgtttccccagcccccccagctacccaagcactgtcagcaca
gtggaaggccacgggacccccttgtcacccaccatacatgtgcaggaggctccttggaaa
ctaccttccaaaaggacgcattactacgaaacactgggacgctccagttccagagacagc
cagctggcaattgtttgccaagaggaagtgtctcaggatgagacttatgatgaaaatttg
aatgaagacattgagtactgtagtgaaccaagtctgctctctaccgaaatgctcgcatac
caagatgatgaaaacagacaacttactccaccagaaaacaacaaaggagaggacacccgg
cattctccgaagaaagggtttctgtgctcctcagcactaggtcgaagagcatcttttcac
ttagagtgtttgaaaagacagaagaaccagggcgcagatgtttcgcagaagactgttctg
cctttgcatctggtacatcatcaggcattagcggtggccggcctgagtcccctcctccag
cgaagccattcccccaccatgttctctcggctgtgtgctacaccccccgctacaccctgc
agccgtggctggccgcagcagaccatcccgactctgcgcctcgacggggcagagtccagt
gagaagctcaacagcagcttcccatcagtacactgcgggtctcggtaccctgacaacacc
ggctgcagcagcccaaggagagccaggccggtctctctcaccgtccccagccagacagga
gggagcagcaggcagtttcatggcagcgctggcagcctggttgaagcggtcttgatttca
gaaggactgatgcagtttgctcaagatccaaagttcattgaggtcacaacccaggagctt
gcagatgcctgtgacatgacgatagaagagatggaaaatgcagcagacaacattctcaat
ggtaacagcaagcagagccccaatggcaacctcttgccttttgttaactgcagggaccca
gggcaggacagtgcaggagaggaagaggaagaggtgcagaacccggattgtagaaaaagt
caggaggagctcaaggacagcaggatatatatcagcagcctgtag

DBGET integrated database retrieval system