KEGG   Athene cunicularia (burrowing owl): 113476322Help
Entry
113476322         CDS       T05777                                 

Gene name
PFKP
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun00010  Glycolysis / Gluconeogenesis
acun00030  Pentose phosphate pathway
acun00051  Fructose and mannose metabolism
acun00052  Galactose metabolism
acun01100  Metabolic pathways
acun01200  Carbon metabolism
acun01230  Biosynthesis of amino acids
acun03018  RNA degradation
Module
acun_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:acun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    113476322 (PFKP)
   00030 Pentose phosphate pathway
    113476322 (PFKP)
   00051 Fructose and mannose metabolism
    113476322 (PFKP)
   00052 Galactose metabolism
    113476322 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    113476322 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:acun01009]
    113476322 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:acun03019]
    113476322 (PFKP)
Enzymes [BR:acun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     113476322 (PFKP)
Protein phosphatases and associated proteins [BR:acun01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     113476322 (PFKP)
Messenger RNA biogenesis [BR:acun03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     113476322 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 113476322
NCBI-ProteinID: XP_026697549
LinkDB All DBs
Position
2
AA seq 757 aa AA seqDB search
MNAAVRAVVRMGIYVKAKVYFVYEGYQGMVDGGDNIVEVSWESVSSILQVGGTVIGSARC
KSFRTREGRLQAACNLVQRGITNLCVIGGDGSLTGANLFREEWSGLLEELAQKGQIDEEA
VKKYAYLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMG
RHCGYLALVSALACGADWVFIPEYPPEEGWEDSMCVKLSENRARKKRLNIIIVAEGAIDC
HNKPITSEKVKDLVVQRLGFDTRVTILGHVQRGGTPSAFDRILASRMGVEAVLALLEATP
ATPACVVSLSGNQAVRLPLMECVQMTQEVQKAMDEGRFVEAVKLRGRSFENNLNTYKLLS
HKKPDAELPTTNFNVAVLNVGAPAAGMNAAVRAAVRVGITEGHKMFAVIDGFEGFARGKI
KEISWGDVGGWTGQGGSILGTKRTLPAKYLEKIADQMRTNNINALMVIGGFEAYLGLLEL
SAAREKYDEFCVPMVMVPATVSNNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVF
IIETMGGYCGYLANMGALAAGADAAYIFEEQFDIRELQANVEHLTEKMKTSIQRGLVLRN
ENCNENYTTDFIYQLYSEEGKGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISAKAMQWIS
KKLKETYRKEEGKIFANTDDSVCLLGMRRRNLVFQPVAELKTETDFVHRIPKEQWWLKLR
PLMKILAKYKTSYDVSDSGQLEHVAMHSPKEAETGAI
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgctgtgcgcgcagtagtacgcatgggaatctatgtaaaagccaaagtgtat
tttgtttatgagggttatcagggaatggttgatggaggtgataatattgtagaagtttca
tgggaaagtgtttcaagtatcctgcaagtgggaggtacagttattggtagtgcacgctgc
aaatcctttcgtacccgggagggccgccttcaggcagcctgtaacttggttcagagagga
atcactaatctttgtgtgattggcggagatggcagcttaactggtgccaatctgttccgt
gaagaatggagtggacttctcgaagaactggcacagaaaggacagattgatgaagaggct
gttaagaaatatgcttaccttaacattgtgggaatggttggatccatagacaatgacttc
tgtggcactgatatgaccataggtactgactcagccttgcacagaatcattgaagttgtg
gatgccatcatgaccactgctcaaagccatcagaggacatttgtgctggaggttatgggg
agacactgtgggtatctagctcttgttagtgccttagcctgtggtgcagattgggtattt
attcctgaatacccaccagaagaaggatgggaagattcaatgtgtgttaagctttcagag
aatcgtgcacgaaagaaaaggctgaatattattattgtagctgaaggggctattgattgc
cacaacaaacctataacatcagagaaggttaaggatcttgtggttcagcggcttggtttt
gacacccgagttactatcttgggtcatgtgcaaagaggtggaaccccttcagcttttgac
agaattttggcaagtcgtatgggtgtagaagctgtgcttgcccttttagaagctactcca
gctacccctgcatgtgttgtgtccctctctggcaaccaggctgtccgcctgcctttgatg
gagtgtgtgcagatgactcaagaagttcagaaagccatggatgagggaagatttgttgag
gctgtgaagcttcgtggaaggagctttgaaaacaaccttaacacctacaaattactgtca
cacaaaaagccagatgctgagcttccaacgactaattttaatgtggcagttttaaatgtt
ggtgcccctgcagctggaatgaatgctgcagtgagagctgcagtgagagttggcataact
gaaggccataaaatgtttgctgtcattgatggatttgaaggttttgctagagggaagata
aaggaaatcagctggggagatgttggaggctggactggtcaaggaggatcaattcttggt
acaaaacgtactcttcctgcaaaatatttggagaagattgctgaccagatgcgcactaac
aacattaatgcccttatggttattggtggatttgaggcgtacctcggacttctggaattg
tcagctgcccgagagaaatatgacgaattctgtgttccaatggttatggttcctgcaact
gtatccaacaatgtaccgggttcagatttcagcattggtgcagatactgctctgaacact
ataactgatacatgtgatcgcatcaaacagtcagccagtggtaccaagcgtcgtgtattc
atcattgagaccatgggaggttattgtggttatctggctaatatgggggcccttgcggca
ggagctgatgctgcttatatctttgaagaacagtttgatattcgagagctccaggctaat
gtggaacacttgactgaaaaaatgaaaaccagtatccagcgtggtctagtgctgagaaat
gagaattgcaatgagaattacacaactgacttcatttatcagctgtattctgaagaagga
aaaggagtgtttgactgtcgaaaaaatgtattgggccacatgcagcagggtggtgcacct
tcgccatttgatagaaacttcgggacaaaaatttctgcaaaagctatgcagtggatctca
aaaaaactgaaagaaacctaccgaaaagaagaaggaaaaatatttgccaataccgatgac
tcagtctgtttgctgggaatgcgtagacgcaaccttgtttttcaacctgtggctgagctc
aagactgaaacagactttgtacacaggattcccaaggagcaatggtggctgaagctgcga
ccactgatgaaaatcctggccaagtacaagactagttacgatgtttcagattcaggccag
ctggagcacgttgctatgcacagccccaaggaagcagaaactggagccatctga

DBGET integrated database retrieval system