KEGG   Athene cunicularia (burrowing owl): 113478856
Entry
113478856         CDS       T05777                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun00230  Purine metabolism
acun01100  Metabolic pathways
acun04020  Calcium signaling pathway
acun04114  Oocyte meiosis
acun04261  Adrenergic signaling in cardiomyocytes
acun04270  Vascular smooth muscle contraction
acun04371  Apelin signaling pathway
acun04540  Gap junction
acun04912  GnRH signaling pathway
acun04914  Progesterone-mediated oocyte maturation
acun04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:acun00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    113478856 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    113478856 (ADCY3)
   04020 Calcium signaling pathway
    113478856 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    113478856 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113478856 (ADCY3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    113478856 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    113478856 (ADCY3)
   04916 Melanogenesis
    113478856 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    113478856 (ADCY3)
   04270 Vascular smooth muscle contraction
    113478856 (ADCY3)
Enzymes [BR:acun01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     113478856 (ADCY3)
SSDB
Motif
Pfam: AC_N Guanylate_cyc Bax1-I
Other DBs
NCBI-GeneID: 113478856
NCBI-ProteinID: XP_026702163
LinkDB
Position
3
AA seq 406 aa
MPRNRAFSEPECSAEYSADYSVSLPSDPEHGVGRTHEVTVRSSGPCLCLPRFMRLTFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDCYVLVMCAVVYAADKLAPALVAVAGLVAHVL
LFILCKYRLLPERVARRFLPYVLWVLILAQIFCYLGLNFSRSPEASDTVGWQAFFVFSFF
ITLPLRLAPIVLITAVSCGIHTLVLGVTVAQQQQDTLDEGTLLRQILSNVAIYLCAITVG
TMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLMLSILPKHVADEMLKDMKKDPS
QKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAQELVKLLNELFARFDKLAAEYGF
RFVRRGAIYVKGKGELLTFFLKGREKQGSFVNGSSVTLPHQVVDNS
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgccccggaacagggctttttcagagcccgagtgctcggccgagtactccgccgactac
tcggtgagcttgccgtcggaccccgagcacggcgtggggcggacccacgaggtgacggtg
cgcagttcgggcccctgcctctgcctcccccgtttcatgcgcctcaccttcgctcccgag
tccctggagaacctctaccagacttatttccgtcgccaacgccacgagaccctcctggtg
ctggtggtcttcgccgctctcttcgactgctacgtcctcgtcatgtgcgccgtggtctac
gccgccgacaagctggccccggcgctggtggcggtggccgggctggtcgcccacgtgttg
ctcttcatcctctgcaagtacaggctgctccccgagcgggtggcccgcaggttcctgccc
tacgtcctctgggtcctcatcttggcccagatcttctgctacctgggcctcaacttctcc
cgctcgcctgaagccagcgacacggtgggctggcaggcgttcttcgtgttctccttcttc
atcacgctgccgctgcgcttggcgcccatcgtgctcatcaccgccgtctcctgcggcatt
cacacactggtgctcggtgtcaccgtcgcccagcagcaacaggacaccctggatgagggc
acgctgctgagacagatcctgtccaacgttgccatctacctttgtgccatcacagtgggc
accatgtcctactacatggccgaccgcaagcaccgcaaagccttcctcgaagcccgccag
tccctcgaggtcaagctcaacctggaggagcagagccagcagcaggagcgcctcatgctc
tccatcctgcccaagcacgtggctgatgagatgctgaaggacatgaagaaggacccgagc
cagaaggagatgcagcagttcaacaccatgtacatgtaccgccacgagaacgtcagcatc
ctcttcgcagacatcgtgggcttcacccagctctcctcgtcctgcagcgcccaggagctg
gtgaagctcctcaatgagcttttcgcccgcttcgacaagctggcagccgagtacggcttc
cgcttcgtgcgccggggagccatctacgtcaagggcaaaggggagctgcttaccttcttc
ctcaagggccgggagaagcagggctccttcgtgaacggctcctccgtcaccctgccccat
caggtggtggacaactcatga

DBGET integrated database retrieval system