KEGG   Athene cunicularia (burrowing owl): 113479028Help
Entry
113479028         CDS       T05777                                 

Gene name
SOD1
Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:acun00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    113479028 (SOD1)
Enzymes [BR:acun01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     113479028 (SOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 113479028
NCBI-ProteinID: XP_026702437
LinkDB All DBs
Position
1
AA seq 154 aa AA seqDB search
MPQSAFRDAQWAGSYFGNNKLFPLKGNGPVKVTGEIRGLTDGDHGFHVHEFGDNTNGCTS
AGSHFNPEGKQHGGPSDAERHVGDLGNVTSKGGVAEVAIEDAIISLSGPHSIIGRTMVVH
EKCDDLGRGGDNESKLTGNAGPRLACGVIGIAKS
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgccacagagtgccttcagggatgcacagtgggctggcagttattttggtaataataaa
ttatttccattaaagggtaatggaccagtaaaagttactggagaaatccgtggcttgaca
gatggggatcatggcttccatgtccatgaatttggtgacaatacaaatgggtgtaccagt
gcaggttcccacttcaatcctgaaggcaagcagcatggtggaccaagtgatgcagaacgg
catgtgggagaccttggcaatgtgacttctaaaggaggagtggcagaagtggcaatagaa
gatgccatcatctctcttagtggaccacatagcatcattggacgtaccatggtggtccat
gaaaaatgcgatgacctgggtagagggggagataatgagagcaaattaactggaaatgct
ggccctcgtttagcttgtggtgtaattggaatagcaaagagttaa

DBGET integrated database retrieval system