KEGG   Athene cunicularia (burrowing owl): 113479434
Entry
113479434         CDS       T05777                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun04010  MAPK signaling pathway
acun04020  Calcium signaling pathway
acun04144  Endocytosis
acun04510  Focal adhesion
acun04540  Gap junction
acun04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:acun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113479434 (PDGFRA)
   04020 Calcium signaling pathway
    113479434 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113479434 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113479434 (PDGFRA)
   04540 Gap junction
    113479434 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113479434 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acun01001]
    113479434 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:acun04090]
    113479434 (PDGFRA)
Enzymes [BR:acun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     113479434 (PDGFRA)
Protein kinases [BR:acun01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   113479434 (PDGFRA)
CD molecules [BR:acun04090]
 Proteins
  113479434 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE Kinase-like
Other DBs
NCBI-GeneID: 113479434
NCBI-ProteinID: XP_026703135
LinkDB
Position
4
AA seq 1088 aa
MGTSPRMFLILGCFLTGPFLTFCQLPLPTIVPNRNEMVVQLNSNFTLRCSGDSEVSWQYP
VTEGSHRIDIRHEENNSGLFVTVLEVRNASAAHTGLYVCYYNHTQVEDGEVEGKDIYIYV
PDPDMPFVPSIPEDQFILVEEGDPTIIPCRTSHPNAQVTLINSLDKAVYAFYDSKQGFIG
NFPAGSYTCRTTVKGVEFKSDEFLIYILRATSQLPVEIEALKTVYKTGETIVVTCVVFDN
EVVNLQWNYPGKVKEKGLIKLDDIKVPSQKLVYTLTIPEASVKDTGDYECTARHATKEVK
ENKKVVITVHEKGFVHLEPQFSPLEAVNLHEVKNFVVDVQAYPAPKMYWLKDNVTLIENL
TEIVTSSSRLQETRFQSILKLIRAKEEDSGYYTLVAENEDEIKRYTFSLLIQVPALILDL
VDDHHGSAGGQTVRCLAEGTPLPDVEWLVCKDIKKCSNDTSWTLLTNNISDIHMEAHLDE
KNMVESQVTFQKVEETLAVRCVARNDLGAVTRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLNRHPEKPKKDLDIFGMNPADESTRSY
VILSFENTGEYMDMKQADTTQYVPMLERKEGSKYSDIQRSVYDRPASYKKKSISVESEVK
NLLSDDSSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGL
ARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGM
MVDSTFYNKIKSGYRMAKPDHATNEVYEIMVKCWNSEPEKRPSFYHLSEIVESLLPGEYK
KSYEKIHLDFLKSDHPAVTRMRGDCDNAYIGVTYKNEDKLKDRESGFDEQRLSADSGYII
PLPDIDPVSEDELGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSS
DLVEDSFL
NT seq 3267 nt   +upstreamnt  +downstreamnt
atgggtacttctccccggatgttcctgatcctgggatgttttctcacaggaccgttccta
acattttgccagcttcctctgccgactattgttcctaataggaatgaaatggtggtacag
ctgaattccaatttcacactcagatgctctggagacagcgaagtgagctggcagtaccca
gtgaccgagggaagccacaggatagacattagacatgaagaaaacaacagtggccttttc
gtgacagtgctcgaagtacgaaatgcctcagctgctcatacgggcttgtatgtttgctat
tataaccacactcaagtggaggatggggaagtggaagggaaggacatctacatctatgtg
cctgacccagacatgccttttgttccttctataccagaagaccagttcatcctagtagaa
gaaggtgatcccaccattatcccttgtcggacgagtcacccaaatgctcaagtgacttta
attaacagtttagacaaggctgtctatgctttctatgacagcaaacaaggcttcataggg
aatttccctgcgggctcatatacatgcagaacaacggttaaaggtgtggagttcaagtct
gacgagttcctcatctatattttaagagctacttcacagctgccggttgaaattgaagct
cttaaaactgtctacaaaacaggcgagaccatcgtagtaacttgtgtggtctttgacaat
gaggtggttaatttacagtggaattatcctgggaaagtgaaagaaaaaggtctgataaaa
cttgatgatatcaaggtcccatcgcagaagctggtttacactctgaccattcccgaggca
tcagtgaaagacacaggggattatgaatgtacagctcgacatgcaaccaaggaggttaag
gaaaataagaaagtagtcattacagttcatgagaaaggctttgttcacctggagcctcag
tttagccctctggaagctgtcaatctacatgaagtcaaaaactttgtggttgatgtgcag
gcatacccagcaccaaaaatgtactggttgaaggataacgtgactctgattgaaaatctt
actgagattgttactagttccagcagactccaggagacaaggtttcagagtatattaaaa
ttgatccgggccaaggaggaagacagtggatactatactttggttgctgaaaatgaagat
gagattaaaagatacaccttctccttgctaatacaagttccagccttgatcttagacctt
gtggatgatcaccatggctctgcaggtgggcagacagtgaggtgcttggcggaggggacc
ccacttcctgatgtggaatggctggtttgcaaggacattaagaagtgtagcaatgacacc
tcatggactcttttgactaacaatatctcagatatacacatggaagcccacctggatgag
aaaaacatggtagaaagccaggtgaccttccagaaggtagaggaaaccctggctgtgaga
tgcgtggcaaggaatgatcttggtgctgtcactcgggaactgaagcttgtggctcccacc
ctgcgatcagaactgacagtggctgctgcagtcttagtgctgttagtgattgtgataatt
tcactgattgtcctggtcatcatatggaaacagaagccgaggtatgagataagatggaga
gtcattgagtctattagccctgacggccatgaatacatttatgtggacccaatgcaactg
ccttacgactccagatgggagtttcctcgagatgggttagtgcttggtcgaatccttggt
tctggtgcttttggaaaagtagtcgaagggactgcgtatggattgagtcgctctcaacca
gtgatgaaagtagctgtgaaaatgctgaaacctacagctagatccagtgaaaaacaggcg
ctcatgtctgaactgaagataatgacacatcttggcccccacctgaatattgtgaatctg
cttggagcttgtacaaaatcaggtcctatttacatcatcactgaatactgtttttatggt
gatttggtgaactatctgcataagaacagggacaatttcctgaaccgacacccagagaag
ccaaagaaagatttggatatctttgggatgaacccagctgatgaaagcacaagaagttat
gtgatactatcatttgaaaacactggagaatacatggacatgaaacaagctgatactact
cagtatgtgccaatgctagaaaggaaggagggatctaaatactctgatattcagagatct
gtgtatgatcggcctgcttcatataagaagaaatctatttcagtagaatcagaagtcaaa
aaccttctttcagatgacagttcggagggcctcagcctactggatttgctgagcttcacc
tatcaggttgcacgaggaatggaattcttggcttctaaaaattgtgtgcaccgtgacttg
gcagctcgtaatgtcctcctggctcaaggaaaaattgtgaagatctgtgactttgggctg
gctagagacatcatgcatgattccaactatgtctccaagggcagtactttcctcccagta
aaatggatggcacctgaaagcatttttgacaatctgtacacaacgttaagtgatgtctgg
tcttatggcattctgctgtgggaaatattttctcttggtggcacaccatatcctggcatg
atggtcgattctactttctacaataagatcaagagtggataccgaatggccaaacctgat
catgctaccaacgaagtgtatgagatcatggtgaagtgctggaacagtgaaccagagaaa
agaccttctttttaccatttaagtgaaattgtggagagtttgttgcctggagagtacaaa
aagagctatgagaaaattcacttggacttcctgaaaagtgatcacccagctgtcacacgc
atgagaggggactgtgacaatgcttacattggtgtcacctacaagaatgaagacaagcta
aaggacagggagagtggatttgatgagcagaggctgagtgctgacagcgggtacatcatt
cccctgcctgacattgaccctgtttctgaagatgaacttggcaaaaggaacaggcacagt
tcccagacatctgaagaaagtgctattgaaactggttccagtagctctactttcatcaag
agagaagacgagaccattgaggacattgacatgatggatgacattgggattgactcctca
gacctggtggaggacagcttcctgtaa

DBGET integrated database retrieval system