KEGG   Athene cunicularia (burrowing owl): 113480320Help
Entry
113480320         CDS       T05777                                 

Gene name
MAP3K9
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 9 isoform X1
  KO
K04417  mitogen-activated protein kinase kinase kinase 9 [EC:2.7.11.25]
Organism
acun  Athene cunicularia (burrowing owl)
Brite
KEGG Orthology (KO) [BR:acun00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acun01001]
    113480320 (MAP3K9)
Enzymes [BR:acun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     113480320 (MAP3K9)
Protein kinases [BR:acun01001]
 Serine/threonine kinases: TKL group
  MLK family
   113480320 (MAP3K9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Pkinase_fungal DUF1476 OmpH DUF3552
Motif
Other DBs
NCBI-GeneID: 113480320
NCBI-ProteinID: XP_026704836
LinkDB All DBs
Position
5
AA seq 888 aa AA seqDB search
MLKHPNIIALRGVCLKEPNLCLIMEFARGGSLNRVLSGKRIPPDILVNWAVQIARGMNYL
HEEAIVPIIHRDLKSSNILILEKVENGDLSNKILKITDFGLAREWHKTTKMSAAGTYAWM
APEVIRSSMFSKGSDVWSYGVLLWELLTGEVPFRGIDGLAVAYGVAMNKLALPIPSTCPE
PFAKLMEDCWNPDPHSRPSFTSILDHLTAIEESGFFEMPKDSFHSLQEDWKQEIQEMFDQ
LRAKEKELRTWEEELTRAAVEQKNHEELLRRREQELAEREIDILERELNIIIHQLCQEKP
RVKKRMGKFKRNRLKLKDGNHISLPSDFQHKFTVQASPTMDKRKSLISSCSSPPASPTII
PRLRAIQLTPAESSKTWGRSSVLPKEEGEEEEKRGQKKKGRTWGPSSLCHKELGAGEDGL
KALVEGYKQWSSSAPNLGKIQRTAPAFPGFTSLAEMDDEDSECLNGEGKVHPSPGHNQSY
LCIPFQKNEDWDGPSSDANDESTPVNSATSTPQLTPTNSLKRSGSHHKRCEVALLGCGAV
LAAAGLGFDLLEAGKCQLLIEEEPEAPKEEKKKRDSIFQRAGRPRRSTSPPSRKIFKKDD
PMLLLGEPSTSLTLLSLSSISECNSTRSLLRSDSDEIVVYEMPVSPVTVKAPLPAITNPL
VNVQIERFKQDPNQSLTPTHVTVSSHTQQSGHRRTPSDGAIKGSGLVVNGCPTSGCPSSS
CLTGALGAGVLKTPSPSRDPNEVPRLPDPNLVFPPTPRRWNAQQDPTLERPKTLEFLPRP
RPAASRQRLDPWWFVSPSNAKGESSANSSSTDTPSNLDSCFASSSSTVEERPGLPALLPL
QVGLPVEERTLLDIDAEGQSQDSTIPLCRSELNTHKAAAYELKQEFWS
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagcatcccaacatcattgccctcaggggtgtgtgtttgaaggaacctaatctt
tgcttgatcatggagtttgcccgtggaggatcgctaaatagggtgttgtctggtaaaagg
atacctcctgacatactagtgaactgggcagtgcagattgcgaggggaatgaactacctg
catgaggaagcgattgttcccataattcaccgtgacctgaagtccagcaacatactgata
ctcgaaaaggtggaaaatggagatctgagcaacaagatattgaagatcacggatttcggc
ttggccagggaatggcataaaactaccaaaatgagtgcagctgggacatatgcctggatg
gctcctgaggtcatccgctcctccatgttctccaaaggcagcgatgtgtggagttatggt
gtgctgctttgggaactgctaacaggagaagtaccattccgaggaattgatggtcttgca
gtagcatatggtgttgccatgaataaacttgcccttccaattccttccacgtgtccagag
ccctttgccaaactcatggaagattgttggaaccctgacccacactcacgaccttccttt
accagtatcctagaccatctcactgccatagaagagtctggtttctttgaaatgcccaaa
gattccttccactccctgcaggaagactggaaacaagagattcaagagatgtttgatcag
ctcagagccaaagaaaaggagctgcgcacatgggaagaagagctgactcgtgctgctgtt
gaacagaagaatcatgaggagctgctacgaaggcgggaacaggagctggcagaacgtgag
attgatatcctggaaagggagctcaacatcatcatccaccagctgtgtcaggagaagcct
cgggtgaagaaacgcatggggaagttcaaaaggaacaggctgaagttaaaagatggcaat
catatcagcctgccttcagatttccagcataaattcactgtgcaggcttctccaacaatg
gataaaagaaaaagcttgatcagtagctgctccagccctcctgcaagtcctaccattatt
cccagactcagggccatacagttgactcctgctgaaagcagcaaaacatggggacggagc
tcagtccttcccaaggaggaaggagaggaagaagagaagcgaggccagaagaaaaaggga
cgcacttggggaccgagctcactttgtcacaaggagctaggtgcaggagaagatggtctg
aaagctctggtagaaggatacaaacagtggtcatccagtgcaccaaaccttgggaagatc
cagagaactgcacctgcttttccgggattcaccagcttagcagagatggatgatgaagac
agtgaatgtcttaatggagagggcaaagtgcacccttcacctgggcacaatcagtcatac
ctctgcatcccatttcagaagaatgaggactgggatggcccttctagtgatgccaatgac
gagtccacccctgtgaactctgctaccagtaccccgcagctgacacccaccaacagcctc
aaacgtagtggctcccaccacaagcgatgtgaggttgcattgcttggctgtggagcagtg
ctggctgctgcaggcctgggttttgatctgttagaagcagggaagtgtcagctgctgatt
gaggaggagccagaggcacccaaggaagagaagaagaagcgtgacagcattttccagcga
gctggacgcccacgcaggagcactagtccaccttcccgaaagatcttcaagaaagatgat
cccatgttgttgctaggcgagccatccacatccctcacccttctttccctgtcttccatt
tccgaatgtaattccacccggtccctgctgcgctcagacagtgatgagattgtggtgtat
gaaatgcctgtcagcccagtgacagtcaaggctcccttgccagccattaccaacccacta
gtcaatgtccagatcgagaggttcaaacaagaccccaaccagtccctgactcccacacat
gtgacggtctcttcccacacccagcaaagcgggcacaggcgcacaccttctgatggggcc
atcaaagggagtggactagttgtgaatgggtgcccaaccagtggatgcccttccagtagc
tgtttaactggagcactgggagcaggtgtgttaaaaacacctagtccaagtagagatccc
aatgaggtccctcgcctgccagaccccaaccttgtttttcctccaaccccgagacgatgg
aatgcacagcaggaccccacactggaaagacccaagacattggagttcctgccccggcca
cgtcctgcagccagtcggcagcggcttgatccctggtggtttgtgtcacccagcaatgcc
aagggtgaatcttctgccaacagttcaagtactgatactccaagcaatctggactcttgt
tttgctagtagcagcagcactgtagaagagaggcctgggctgcctgcactgcttcctctc
caggtgggtcttcctgtagaggagcggacactgttggacatagatgctgaggggcagagt
caggacagcaccattccgctatgcagaagtgaacttaacacacacaaagctgcagcttat
gaactcaagcaagaattctggtcttag

DBGET integrated database retrieval system