Athene cunicularia (burrowing owl): 113480730 Help Entry 113480730         CDS       T05777                                  Symbol CALM1 Name (RefSeq) calmodulin-1   KO K02183   calmodulin Organism acun  Athene cunicularia (burrowing owl) Pathway acun04020   Calcium signaling pathway acun04070   Phosphatidylinositol signaling system acun04114   Oocyte meiosis acun04218   Cellular senescence acun04261   Adrenergic signaling in cardiomyocytes acun04270   Vascular smooth muscle contraction acun04371   Apelin signaling pathway acun04625   C-type lectin receptor signaling pathway acun04744   Phototransduction acun04910   Insulin signaling pathway acun04912   GnRH signaling pathway acun04916   Melanogenesis Brite KEGG Orthology (KO) [BR:acun00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     113480730 (CALM1)    04020 Calcium signaling pathway     113480730 (CALM1)    04070 Phosphatidylinositol signaling system     113480730 (CALM1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     113480730 (CALM1)    04218 Cellular senescence     113480730 (CALM1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     113480730 (CALM1)   09152 Endocrine system    04910 Insulin signaling pathway     113480730 (CALM1)    04912 GnRH signaling pathway     113480730 (CALM1)    04916 Melanogenesis     113480730 (CALM1)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     113480730 (CALM1)    04270 Vascular smooth muscle contraction     113480730 (CALM1)   09157 Sensory system    04744 Phototransduction     113480730 (CALM1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:acun01009]     113480730 (CALM1)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:acun04131]     113480730 (CALM1)    03036 Chromosome and associated proteins [BR:acun03036]     113480730 (CALM1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:acun04147]     113480730 (CALM1) Protein phosphatases and associated proteins [BR:acun01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      113480730 (CALM1) Membrane trafficking [BR:acun04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     113480730 (CALM1) Chromosome and associated proteins [BR:acun03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      113480730 (CALM1) Exosome [BR:acun04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    113480730 (CALM1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 AIF-1 EF-hand_4 EFhand_Ca_insen EF-hand_11 UPF0154 SPARC_Ca_bdg DUF1103 DUF5580_M Dockerin_1 Poly_export SurA_N_2 SurA_N_3 Motif Other DBs NCBI-GeneID:  113480730 NCBI-ProteinID:  XP_026705623 LinkDB All DBs Position 5 AA seq 113 aa AA seqDB search MRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKD GNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgaggtcattgggtcaaaatccaacagaagcagaattgcaggatatgatcaacgaggta gatgctgatggcaatggcactatcgacttccctgaatttttaaccatgatggccagaaaa atgaaggacacagacagtgaagaagaaattcgtgaggcattccgagtctttgacaaggat ggcaatggctatatcagtgcagcagaactacgtcacgttatgacaaacttaggagaaaag ctaacagatgaagaagtagatgaaatgatcagagaagcagacattgatggggatgggcaa gtcaactatgaagaattcgtacagatgatgactgcaaagtga

DBGET integrated database retrieval system