Athene cunicularia (burrowing owl): 113481185 Help Entry 113481185         CDS       T05777                                  Symbol RRAS2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism acun  Athene cunicularia (burrowing owl) Pathway acun04010   MAPK signaling pathway acun04137   Mitophagy - animal acun04140   Autophagy - animal acun04218   Cellular senescence acun04371   Apelin signaling pathway acun04625   C-type lectin receptor signaling pathway acun04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:acun00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     113481185 (RRAS2)    04371 Apelin signaling pathway     113481185 (RRAS2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     113481185 (RRAS2)    04137 Mitophagy - animal     113481185 (RRAS2)   09143 Cell growth and death    04218 Cellular senescence     113481185 (RRAS2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     113481185 (RRAS2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     113481185 (RRAS2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:acun04147]     113481185 (RRAS2)    04031 GTP-binding proteins [BR:acun04031]     113481185 (RRAS2) Exosome [BR:acun04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    113481185 (RRAS2)   Exosomal proteins of bladder cancer cells    113481185 (RRAS2) GTP-binding proteins [BR:acun04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     113481185 (RRAS2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf ATP_bind_1 MMR_HSR1 Motif Other DBs NCBI-GeneID:  113481185 NCBI-ProteinID:  XP_026706420 LinkDB All DBs Position 5 AA seq 182 aa AA seqDB search MCLFLHTNLFHFLQSYFVTDYDPTIEDSYTKQCVIDERAARLDILDTAGQEEFGAMREQY MRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILVGNKADLDHQRQVTQEEG QQLARQLKVTYMEASAKIRLNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCV IF NT seq 549 nt NT seq  +upstreamnt  +downstreamnt atgtgcttgttcttacacacaaacttgtttcattttctgcagtcctattttgttacggat tatgatccaacgattgaagactcctacaccaagcagtgtgtaatagatgagagagctgcg cgtttggacattctggatacagcaggacaagaagaattcggagccatgcgtgaacagtac atgaggacaggggagggttttctgcttgttttctcagtcactgatagaggaagttttgaa gaaatctataagtttcagcgacaaattcttagagtgaaagatcgtgacgaatttcctatg attctagttggtaataaagcagatctggatcaccaaagacaggtgacacaagaggaaggt cagcagctggcacggcaacttaaagtaacgtacatggaagcctcagcaaaaatcagattg aatgtagaccaagcttttcatgaacttgtcagagttataaggaaatttcaagaacaagag tgccctccttcaccagagccaacacggaaagaaaaagacaagaaaggctgccattgtgtt attttctga

DBGET integrated database retrieval system