KEGG   Athene cunicularia (burrowing owl): 113481227
Entry
113481227         CDS       T05777                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun04068  FoxO signaling pathway
acun04110  Cell cycle
acun04115  p53 signaling pathway
acun04218  Cellular senescence
acun04310  Wnt signaling pathway
acun04340  Hedgehog signaling pathway
acun04371  Apelin signaling pathway
acun04510  Focal adhesion
acun04530  Tight junction
Brite
KEGG Orthology (KO) [BR:acun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    113481227 (CCND1)
   04340 Hedgehog signaling pathway
    113481227 (CCND1)
   04371 Apelin signaling pathway
    113481227 (CCND1)
   04068 FoxO signaling pathway
    113481227 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    113481227 (CCND1)
   04115 p53 signaling pathway
    113481227 (CCND1)
   04218 Cellular senescence
    113481227 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113481227 (CCND1)
   04530 Tight junction
    113481227 (CCND1)
SSDB
Motif
Pfam: Cyclin_C
Other DBs
NCBI-GeneID: 113481227
NCBI-ProteinID: XP_026706476
LinkDB
Position
5
AA seq 153 aa
MELLLVNKLKWNLAAMTPHDFIEHFLTKMPLAEDTKQIIRKHAQTFVALCATDIKFISNP
PSMIAAGSVVAAVQGLHLGNTNTFLSYQCLTHFLSQVIKCDPDCLRACQEQIESLLESSL
RQAQQHNVSSETKTVEDEADLSCTPTDVRDVNI
NT seq 462 nt   +upstreamnt  +downstreamnt
atggagctgcttctggtgaataagctgaaatggaatctggctgcaatgaccccccacgat
ttcattgaacatttccttactaaaatgcctctggcagaggacaccaagcagatcatccgt
aaacatgctcagacttttgtggctctgtgcgctacagatattaaatttatttcaaaccca
ccttccatgatcgcagctggcagtgtggtagcagctgtgcaaggcctgcatctggggaac
actaacactttcctctcctatcaatgcctcacacatttcctatcacaagttatcaaatgt
gatccggattgtttacgagcctgccaagaacagattgaatccctccttgaatccagtcta
cgtcaggcacagcagcacaatgtatcttcagaaacaaagactgtagaggatgaagcagac
ctttcctgcacacctactgatgtgcgagatgtgaacatttaa

DBGET integrated database retrieval system