KEGG   Athene cunicularia (burrowing owl): 113481475Help
Entry
113481475         CDS       T05777                                 

Definition
(RefSeq) glutathione S-transferase omega-1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun00480  Glutathione metabolism
acun00980  Metabolism of xenobiotics by cytochrome P450
acun00982  Drug metabolism - cytochrome P450
acun00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:acun00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    113481475
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    113481475
   00982 Drug metabolism - cytochrome P450
    113481475
   00983 Drug metabolism - other enzymes
    113481475
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acun02000]
    113481475
Enzymes [BR:acun01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     113481475
Transporters [BR:acun02000]
 Other Transporters
  Pores ion channels [TC:1]
   113481475
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_C_2 GST_C_3 GST_N_2 GST_C GST_N GST_C_5
Motif
Other DBs
NCBI-GeneID: 113481475
NCBI-ProteinID: XP_026706939
LinkDB All DBs
Position
6
AA seq 221 aa AA seqDB search
MTAFHHDIEWTGAELSLFGSCFFCSFSHEIININLKNKPDWFFEKNPFGMVPVLETSKGQ
LIYESPITCEYLDEAFPGKKLMPSDPYERAFQKMLLEHFSKITPIVFKYFVAVKDGQDAT
ALKAEIAEKFGKLEEILSKRDTVFYGGDSISMLDYMIWPWFERLEPFQLKDALSHTPKLQ
RWMEAMKEDPAVKATMTDPQTFKDYLQLYLKNSPEACDYGL
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgactgcatttcatcatgatatagaatggactggagcagaactgagcctgtttgggtct
tgtttcttttgctcttttagccatgaaataatcaacatcaatctgaagaataaacctgac
tggttctttgagaagaacccctttgggatggttcctgttctggagaccagcaagggccaa
ctgatctatgagtccccaatcacttgcgagtatttggatgaagcatttccggggaagaag
ttgatgccttcggacccatatgagcgagcctttcagaagatgctcttggaacatttctca
aagataacacccatagttttcaagtattttgtggccgtcaaagatggacaggatgccacg
gcgctgaaagcagagattgctgaaaagtttggcaaactcgaagagattctgtccaaacgc
gacactgtgttttatggtggagactcaatctccatgcttgactacatgatctggccatgg
tttgaacgtctggaaccattccagctgaaggacgctctgagtcacaccccaaagctccaa
cgctggatggaggccatgaaggaggaccctgctgtcaaggctacaatgactgacccacag
acattcaaagattacctccagctctatttgaagaacagccctgaggcatgcgattacggg
ctctga

DBGET integrated database retrieval system