KEGG   Athene cunicularia (burrowing owl): 113481495Help
Entry
113481495         CDS       T05777                                 

Gene name
EIF3A
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A
  KO
K03254  translation initiation factor 3 subunit A
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun03013  RNA transport
Brite
KEGG Orthology (KO) [BR:acun00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    113481495 (EIF3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:acun03012]
    113481495 (EIF3A)
Translation factors [BR:acun03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    113481495 (EIF3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 113481495
NCBI-ProteinID: XP_026706986
LinkDB All DBs
Position
6
AA seq 1337 aa AA seqDB search
MKSKKHRTWQKIHEPIMLKYLELCVDLRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYL
KLAEEKTEAAKEESQQMVLDIEDLDNIQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLW
ESYRQCLDLLRNNSRVERLYHDIAQQAFKFCLQYTRKAEFRKLCDNLRMHLGQIQRHHNQ
STAINLNNPDSQSMHLETRLVQLDSAISMELWQEAFKAVEDIHGLFALSKKPPKPQLMAN
YYHKVSTVFWKSGNALFHASTLHRLYHLSREMRKNLTQEEMQRMSTRVLLATLSIPITPE
RTDIARLLDMDGIIVEKQRRLATLLGLQAPPTRGSLINDMVRFNVVQYVVPEVKELYNWL
EVDFHPLKLCSRVSKVLNWVKDQAEKEPELQLYVPHLQNNTILRLLQQVAQIYQSIEFSR
LATLVPFVDAFQLERSIVDAARHCDLQVRLDHTTRTLSFGSDLNYSTREDAPLGPQLQSM
PSEQIRNQLTAMSSALAKALAVIKPPHLLQEKEEQHQLAVTAFLKNSRKEHQRILARRQT
IEERKERLESLNIQREKEELEQREAELQKVRKAEEERLRQEAKEREKERILQEHEQIKKK
TVRERLEQIKKTELGAKAFKDIDIEDLEELDPDFIMAKQVEQLEKEKKELQERLKNQEKK
IDYFERAKRLEEIPLIKTAYEEQRVHDMELWEQQEEERITTLQLEREKALEHKNRLSRML
EDRDLFEARLKASRRTVYEDKLKQFQERLAEERRNRLEERKKQRKEERRVTYYREKEEEE
QRLREEQLLKEREEKERIEREKREQEQREYQERVKKLEELEKKKRQREMEIEERERRREE
ERRGLDDPFSRKESRWGDRESESSWRRGGEAESEWRRAPVERDWRRGEARDDERPFRRGD
DLPRRGDDLPRRGDDLPRRGAAEEKERPSMESTEERPPRREGDEERPPRREGDEDRPPRR
GLDEDRPPRRGLDDDRGSWRAADDDRGPRRVLDDDRPPRRALDDDRPPRRALDDDRPPRR
GLDDDRGSWRAADDDRGPRRGLDDDRPPRRALDDDRPPRRGLDDDRGSWRAADDDRGPRR
GLDDDRGPRRGLDDDRMSRRDDDRGPWRSADDDRLSRRDDDRGPWRSGDDSRPGPWRPFG
KPGGWREREKAREDSWGPPRDSRPPGDREWDRDKDRDENEKDREFDRERDFDRDDRFRRP
RDDAGWRRGPAEENSSWRDSSRREEWDRGGRDMRDRRTDDRDPPLRRGPPLRSDREEPSS
WRRADDRREERGEERETVRRSAPAPAAPPASAPPPASKDRERDGEKEKGSWKTEKEREPL
RRTKNETDEEGWTTVRR
NT seq 4014 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtaaaaaacaccgaacatggcagaaaatccacgagccaattatgctgaagtac
ctggaactctgtgtggatctccgcaagagtcacctggccaaagaaggactgtaccagtac
aagaatatttgccagcaggtgaacatcaaatctttggaggatgttgttcgagcctattta
aaattagctgaagaaaaaacagaagcagctaaggaagaatcccagcagatggtactggac
atagaagacttagataacattcaaactccagaaagtgttcttttgagtgctgtaagtgga
gaagacacccaggatcgtactgaccgactgcttttgacaccctgggttaagtttctgtgg
gagtcatatagacaatgtttggatcttctccgaaataactcacgagtggaacgcctgtac
catgatattgcacagcaagcttttaagttctgcctgcagtacacgcgtaaagctgagttc
cgtaagctctgtgataacctacgcatgcatctggggcagatccagcgtcatcataaccaa
agcacagcaatcaacctcaacaatcctgacagtcagtcgatgcacttggagaccaggctt
gtgcaacttgacagtgctattagcatggagctgtggcaggaagctttcaaagcagtggaa
gatattcatgggctatttgcattgtctaagaaaccacccaaaccacaactgatggcaaat
tactatcacaaagtttcaactgtcttctggaaatcgggaaatgctctttttcatgcatcc
acacttcaccggctttatcacttatcaagagaaatgcgaaagaatctcacacaagaggag
atgcagaggatgtctactcgcgtccttttggccactctgtcaattcctataactcctgag
agaactgatattgctcgccttctggatatggatggcatcattgttgagaaacagcgacgt
ctggcaaccctgttgggtcttcaggccccacccacacgtggcagtctcattaatgatatg
gtaaggttcaacgtagtgcaatatgttgttccagaagtgaaagaactttacaattggctt
gaagtagactttcatccgctcaagttatgtagccgtgtcagcaaggttctgaactgggtg
aaggaccaagctgaaaaggaacctgaactccagctgtatgttcctcacctgcagaacaat
accattcttcgccttctgcagcaggtggcccagatttatcaaagcattgaattttctcgt
ctggctaccctggttccttttgttgatgctttccagctggaacgtagtatcgttgatgca
gccagacattgtgacttacaagtgcgccttgatcatactacccggacactgagttttggc
tcagatttgaactacagtactcgagaagatgctccactaggccctcagctacagagcatg
ccttctgagcaaattagaaatcaattgactgctatgtcctcagctctagctaaggctctt
gcagtcattaagcctcctcacttactgcaagagaaggaagaacaacatcagctggcagtc
accgccttcttaaaaaattcaaggaaggagcatcagcgtatccttgcacgtcgtcaaact
atagaggaaagaaaagagcgcctagaaagtttaaacattcagcgtgaaaaagaagaacta
gaacaacgtgaagcagaattacaaaaagtccggaaagctgaagaagagagactgcgccag
gaggcaaaggaaagagagaaggagcgtatcctgcaagagcatgaacaaatcaaaaagaag
actgttcgtgagcgcttggagcagattaagaagactgaactgggagccaaagcatttaaa
gatattgatattgaggatcttgaagagttggatcctgacttcattatggctaaacaagtt
gaacagcttgaaaaagaaaagaaggaactccaggaacggttgaagaatcaggagaaaaag
attgactattttgaaagagcgaagcgattagaagaaattcctttaataaagactgcatat
gaggagcagagagtgcacgacatggagctgtgggagcaacaggaagaagaaaggatcacc
actttgcagttggagcgcgagaaagcccttgagcataagaacagactctcaaggatgttg
gaggatagagatttatttgaagccaggctcaaagcatcacgacgaacagtttatgaggat
aaactcaagcagttccaggaacggttagcagaagagaggcgtaaccgtttggaggaacgg
aagaaacaacgcaaagaagagaggcgcgttacttactacagagaaaaggaggaagaagaa
caaagattacgagaagaacagctgcttaaagagcgtgaggaaaaggaacgcattgagcgt
gagaaacgtgagcaggaacagcgtgaataccaggaacgtgtcaaaaaactggaagaactg
gagaagaaaaaacgtcaaagagaaatggagatagaagaaagagagcgtcgtcgagaagaa
gaaaggagaggtctggatgaccccttttcaagaaaggaatctcgttggggtgatagggag
tctgaaagctcctggagaagaggtggtgaggcagaatctgaatggcggcgagcaccagtg
gaaagagattggcgtcgaggagaagcaagagatgatgaaagacctttccgacgcggggat
gatctgccccgacgcggggatgatctgccccgacgcggggacgatctgccccgacgtggt
gctgcagaagaaaaggaacgtccttctatggaatccacggaggagaggccgccgaggcgc
gaaggggatgaggagaggccaccgaggcgtgaaggggatgaggacaggccgcccagacgt
ggattggatgaggacaggcctcccaggcgtggtttggatgatgacagaggaagctggcgg
gctgcagatgatgacaggggtcccagacgtgttttggatgacgacaggccacccagacgt
gctttagatgacgacagaccacccagacgtgctttggacgacgacagaccacccaggcgt
ggcctggacgacgacagaggcagttggcgtgcagcagatgatgacagagggcccaggcgc
gggctggacgacgacaggccgcccagacgggctttggatgatgacaggccacccaggcgc
gggctggatgacgaccggggcagctggcgtgctgcagatgacgacaggggtcccaggcgt
gggctggatgatgacagaggtcccaggcgggggctggacgacgacaggatgtcaaggcgt
gatgatgaccggggaccatggcgcagcgcggatgatgacaggctctccaggagagatgat
gacaggggtccgtggcggagtggtgatgattcaaggccaggtccttggagaccgtttggt
aaaccagggggatggagagaacgagaaaaggctcgtgaggacagttgggggcctccccgc
gactccagacctccaggagaccgtgaatgggatagagacaaagatcgtgatgaaaatgaa
aaggatcgtgagtttgacagagagagagattttgatcgagatgatcgtttcaggcgtccc
agggatgacgctggttggagaagaggaccagctgaggaaaattctagctggagagattca
agtcgccgtgaagaatgggacagaggtggtcgtgacatgagagatcgacgtactgatgac
agagatccacccctcagaagaggaccgccactccgatctgaccgggaagaaccgagctca
tggcggcgtgcagatgataggagggaagaacgtggagaggaacgtgaaacagttcggcga
tcagctcctgctcctgctgctcctccagcttctgctcccccaccagcatcgaaagatcga
gaaagagacggggagaaggagaaaggttcctggaaaacagaaaaggagcgtgagcccctt
cgccgtactaaaaatgagacagatgaagaagggtggaccactgtacgacgttaa

DBGET integrated database retrieval system