KEGG   Athene cunicularia (burrowing owl): 113481846Help
Entry
113481846         CDS       T05777                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun00010  Glycolysis / Gluconeogenesis
acun00051  Fructose and mannose metabolism
acun00052  Galactose metabolism
acun00500  Starch and sucrose metabolism
acun00520  Amino sugar and nucleotide sugar metabolism
acun00524  Neomycin, kanamycin and gentamicin biosynthesis
acun01100  Metabolic pathways
acun01200  Carbon metabolism
acun04910  Insulin signaling pathway
Module
acun_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
acun_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:acun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    113481846
   00051 Fructose and mannose metabolism
    113481846
   00052 Galactose metabolism
    113481846
   00500 Starch and sucrose metabolism
    113481846
   00520 Amino sugar and nucleotide sugar metabolism
    113481846
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    113481846
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    113481846
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:acun04131]
    113481846
Enzymes [BR:acun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     113481846
Membrane trafficking [BR:acun04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    113481846
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 113481846
NCBI-ProteinID: XP_026707605
LinkDB All DBs
Position
6
AA seq 918 aa AA seqDB search
MATRKEPNALDVPSYCCSPLCKIDKYLYAMRLSDETLIDIMARFRREMKNGLSRDFNPTA
TVKMLPTFVRSIPDGSEKGDFIALDLGGSYFRILRVKVSHEKKQTVQMESEIYNTPEDIM
HGSGTRLFDHVAECLGDFMEKQQIKDKKLPVGFTFSFPCRQSKLDEGILITWTKRFKASG
VEGADVVRLLNKAIKKRGDYDADIMAVVNDTVGTMMTCGFDDQRCEVGLIIGTGTNACYM
EEMRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSG
LYMGELVRLILVKMAKEGLLFEGRITPELLTKGKFETKHVSAIEKSKEGLNKAKEILTRL
GVEPSHEDCIAVQHVCTIVSFRSANLVASTLGAILNQLRDNKGVGRLRTTVGVDGSLYKM
HPQYARRLHKTTRRLVPDSEVRFLLSESGSGKGAAMVTAVAYRLSEQHRLIDETLAEFKL
THEQLLQVKKRMRAEMEAGLKKKTHETAKVKMLPTFVRSTPDGTENGDFLALDLGGTNFR
VLLVKIRSGKRRTVEMHNKIYAIPIEVMQGTGEELFDHIVTCISDFLDYMGIKGARLPLG
FTFSFPCKQTSLDAGILLNWTKGFKATDCEGEDVVYLLREGIKRREEFDLDVVAVVNDTV
GTMMTCAYEDPNCEIGLIVGTGSNACYMEEMRNIEMVDGEQGRMCVNTEWGAFGDNGCLD
DIRTIYDKAVDDYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISETLKTR
HIFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSIIVKTVCGAVSRRAAQLCGAGMA
AVVDKIRENRGLEHLEITVGVDGTLYKLHPHFSRIMHQTVKELAPNCDVTFLLSEDGSGK
GAALITAVGCRLRDAEQN
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atggccacgcggaaggagccaaacgccctggacgtgccaagctactgctgctccccgttg
tgcaaaattgataaatatctttacgccatgcggctctctgacgaaacgctgatagacatt
atggctcgcttcaggagagagatgaagaacggcctctccagagattttaacccaacggct
acagtgaagatgctccctacatttgtgaggtccattcctgatggttcagagaaaggagat
ttcattgcactggatcttggcggttcttatttccgaattctgcgagtgaaggtatcacat
gaaaaaaagcagacggtacaaatggaaagtgaaatttataatacgcccgaagatatcatg
cacggcagcggaacacggctttttgatcatgttgctgaatgcctgggagactttatggag
aaacaacaaatcaaagacaagaaattaccagtcgggtttacattttcttttccttgtcga
caatccaaactagatgagggtattctgataacctggacgaagcgcttcaaagcaagtgga
gtggagggagcagatgttgtgaggctgcttaacaaggccatcaagaaacgtggggactac
gatgcagatatcatggctgttgtgaatgacaccgttgggactatgatgacctgtggtttt
gatgaccagcgttgcgaagttggcttgatcattggcactggcaccaacgcctgttacatg
gaggagatgcggcacatcgacctggtggaaggggacgagggcaggatgtgcattaacacg
gagtggggggcctttggagatgatggctcgctagaagacatcaggactgagtttgatcga
gagatcgaccgtggatcccttaatcctggcaagcagctgtttgagaagatggtcagcggg
ctgtacatgggggagctggtaaggctcatcctggtgaagatggccaaggagggtctgctc
tttgaggggagaatcacccccgagcttctcaccaaagggaagtttgagacaaagcatgtt
tctgccatagagaagagcaaagaaggtttgaacaaagccaaagaaattttaacccgcctg
ggggtggagccatcccacgaggactgcatcgccgtccagcacgtctgcaccatcgtgtcc
ttccgctcggccaacctggtggcctctacactgggtgccatcctcaaccagctgcgggat
aacaaaggggtcggccgcctccggaccaccgtgggggtcgatggctccctctacaagatg
catccgcagtacgcccggcgcttgcacaaaaccacccggcgcttggtgcccgactcagaa
gtgcggttcctgctgtcggagagcggcagcgggaagggagcagcgatggtgacggcggtg
gcgtatcggctctcggaacagcaccggctcatcgacgagacgctggctgagttcaagctc
acccacgagcagctgctgcaggtgaagaagaggatgagagcagagatggaagcagggctg
aagaagaagactcatgaaactgccaaagtgaaaatgctgcctacctttgtacgcagcacg
ccggatggaacagagaatggagattttctggcacttgaccttggagggacaaactttaga
gttttgctggtgaaaatccgcagcggtaaaaggagaacagttgagatgcacaacaagatc
tatgccattcctatagaggtgatgcagggaacaggagaagagctgttcgatcacattgtt
acctgcatttctgacttcctggattatatggggataaaaggagcacgtcttcctcttggc
ttcacgttttccttcccttgcaagcagaccagtctggatgctggtatccttctcaactgg
acaaaaggcttcaaagctacagactgtgagggagaagatgtggtatatttgcttagagaa
ggaattaaaagaagagaggagtttgacttggatgtggtggctgtggtgaatgatacggtg
ggcacaatgatgacttgtgcttacgaagacccaaactgtgaaatcggactcattgtggga
actggcagcaatgcctgttacatggaagagatgagaaacatagagatggtggacggtgag
caaggacggatgtgtgtgaacacggagtggggagcgtttggagataatggatgcctggat
gatatcaggacaatatatgacaaagctgttgatgactattcactaaatgctggaaagcaa
aggtacgagaaaatgatcagcgggatgtacctgggggaaatagtccgtaatattttgatc
gacttcaccaaacggggcttcctcttcagaggtcagatttcagagacactgaagaccaga
catatttttgaaaccaagttcctttctcagattgagagtgacaggttagccttgctgcag
gtgcgagccatcctccagcagctggggctcaacagcacctgcgacgacagtatcattgtc
aagacggtgtgcggagcggtgtcgaggcgagcagctcagttgtgcggcgctggaatggct
gcggttgtagataaaattagagagaacagaggattagagcacctggagataacggttggt
gtggatgggactctgtacaaactacatccacatttttcaaggatcatgcaccaaacggtc
aaagagctggcacccaactgcgacgtgaccttcctgctgtcggaggacggcagcgggaaa
ggggcagcgctcatcacagcggtgggatgcaggcttcgcgatgccgagcagaactga

DBGET integrated database retrieval system