KEGG   Athene cunicularia (burrowing owl): 113482227Help
Entry
113482227         CDS       T05777                                 

Definition
(RefSeq) trypsin I-P1-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun04080  Neuroactive ligand-receptor interaction
acun05164  Influenza A
Brite
KEGG Orthology (KO) [BR:acun00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    113482227
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    113482227
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:acun01002]
    113482227
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acun04147]
    113482227
Enzymes [BR:acun01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     113482227
Peptidases [BR:acun01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   113482227
Exosome [BR:acun04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   113482227
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 113482227
NCBI-ProteinID: XP_026708490
LinkDB All DBs
Position
1
AA seq 249 aa AA seqDB search
MKYILFVTFVGVAVAFPSSADDDDDKIVGGYTCAANSIPYQVSLNSGYHFCGGSLISSQW
VVSAAHCYKSRIQVQLGKHNLALTESTEQLISSSKVIRHSGYSSATLDNDIMLIKLSKPA
QLNRAVQTIPLPTSCVATGTTCLISGWGNTLSNGNSFPDTLQCLKAPVLSSSECSKAYPG
KITKNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGIGCAQRGYPGVYTKVCNYVS
WIKATMSAN
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacatactgtttgtcacctttgttggtgtggctgttgccttccccagcagtgct
gatgatgacgacgacaagatcgtgggaggttacacctgtgcagcaaattctatcccctat
caggtgtccctgaattctgggtatcacttctgtggaggttccctcatcagcagccagtgg
gtcgtgtcagctgctcactgctacaagtcccgcatccaagtgcagctcgggaaacataac
ctggcactcacagaatcaacagagcagttgatcagttcatctaaagtcattcgccactct
ggctacagctctgcaacactggacaatgacattatgctcatcaagctttccaaaccagcc
cagctcaaccgagccgtgcaaacaattcctctgcctaccagctgtgtggccacaggcacc
acatgcctaatctctggctggggcaacactctcagcaatggcaattcatttccagatacc
ttgcagtgcctgaaggctcctgtgctctcttcaagcgagtgtagcaaagcctaccctggg
aaaattaccaagaacatgatatgtgtaggattcttggagggagggaaagactcctgccag
ggcgattccggcggtccagtagtctgcaatgggcagctccagggcattgtttcctggggt
atcggatgtgcgcaaagaggctatcccggggtttacactaaggtctgcaattatgtctcc
tggatcaaagcaactatgtctgccaactga

DBGET integrated database retrieval system