KEGG   Athene cunicularia (burrowing owl): 113482608
Entry
113482608         CDS       T05777                                 

Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E-like
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun04010  MAPK signaling pathway
acun04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:acun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113482608
   04020 Calcium signaling pathway
    113482608
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:acun04040]
    113482608
Ion channels [BR:acun04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   113482608
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel Lustrin_cystein
Other DBs
NCBI-GeneID: 113482608
NCBI-ProteinID: XP_026709194
LinkDB
Position
8
AA seq 2200 aa
MILATIIANCIVLALEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFVFHKG
SYLRNGWNVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKS
IMKAMVPLLQIGLLLFFAILMFAIIGLEFYSGKLHRACYTNNSGELEELDPPHPCGVQGC
PPGYECREWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIP
LIIIGSFFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEV
MLAEENKNTGTSALEVLRRATIKRNRTDAMNRDSSDEHCVDISSVGERRLAQRRPLHPTL
GNPLSHSGLKGARVDGASYLRHKERLLRISVRHMVKSQVFYWIVLSLVALNTACVAIVHH
NQPAWLTHFLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSFNCFDCGVTVGSIFEVVWA
IFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFA
LLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVRSGMW
SSIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPM
SAPNMPAIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQRTSQLRRHMQMSSQEGIN
KDEPPLINPHASIFRRKKPGDGVALEKCAEEQGGKGERLPAEGPEQPASGANPGGGEARR
TPSPRAKRDKELWHQKSCHGNCELGEQDGAGGGIEDKARMRQSQRRSRHRRARMEGKEPT
SALGSRSASQEMGLEEASTTVGTQDGDQRGDAAAAEALIQGEMEASGEPIRTNGVPASEA
ELVGTAEEGSSPQAAPEPHQGKIGSLTEQDCSSPDTSEQALLEASRTVSRSEPDLSSITP
NTEKATESTTIMIDVHDSAVVQISNKTDGEASPLKEAETKEDEEEMEKKKRKKEKSETGK
AMVPHSSMFIFSTTNPVRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSDRNKV
LRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFIVVVGALVAFALANALGT
NKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAV
IAVQLFKGKFFYCTDSSKDTEKDCIGNYVDHEKNKMEVKCREWKRHEFHYDNIIWALLTL
FTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIIT
FQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIM
AMIALNTVVLMMKYYSAPYTYELALKYLNIAFTMVFSLECVLKIIAFGFLNYFRDTWNIF
DFITVIGSITEIILTDTKLVNTSSFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFK
ALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFLGSLMLLFRSATGEAW
QEIMLSCLEGKGCEPDTTATSGQNENERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDN
FEYLTRDSSILGPHHLDEFVRIWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKV
AYKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADWQQLDSELQKEILTIWPH
LSQKMLDLLVPMPKTSDLTVGKIYAAMMIMDYYKQSKAKKQRQQLEEQKNAPMFQRMEPS
SLPQEIISNAKALPYLQQDTLSGLSSRSGFPSLSPLSPQEIFQLACMDPAHGQFQEHQSL
EPEVREFQRVQPSNHGSYLPVDTQDHAVSGRASSMPRLTVDPQVVTDTSSMRRSFSTIRD
KRPNSSWLDEFSMERSSDNTYKSRRRSYHSSLQLSARRLNSDSGHRSDGHRSGGRERGRS
KERKHLLSPDISRCNSEERSPQAHDESPERRRESRSPSEGRSQTPNRQGTGSLSESSIPS
ISDTSTPRRGRRQLPPVPPKPRPLLSYASMLRHAGDTSPPPDESEGGSPPNTAGQTESSS
SPVGKQSRQSTPQRYISEPYLALHDDSHASDCGEEETLTFEAAVATSLGRSNTIGSAPPL
RHSWQMPNGHYRRRRRGAGQGVMCGASIDVLSDTEEDDKC
NT seq 6603 nt   +upstreamnt  +downstreamnt
atgatcctggcgaccatcattgccaactgcatcgtgctggctctcgagcagcatctccct
gaggatgacaagacacctatgtcacggagattagaaaagacggagccctacttcattggg
attttctgcttcgaggctgggattaagattgtggctttggggtttgttttccacaagggc
tcatacctgcgcaatggctggaatgtcatggacttcatcgtggtcctcagcggcatcctc
gccactgctgggacacacttcaacacccacgtggacctgcggacgctgcgggccgtgcgc
gtgctcaggcctctgaagcttgtctctggcattcccagcctgcagattgtgctgaaatcc
atcatgaaggccatggtgcctctcctccagattggcttgctgctctttttcgctatcctc
atgtttgccatcatcggcctggagttttacagtgggaagctgcaccgtgcctgctacaca
aacaattcaggtgaactagaggagctggaccccccccatccatgcggggtgcagggttgc
cccccaggctatgaatgccgggagtggattggtcccaacgatgggatcacacagtttgac
aacatcctctttgctgtgctgaccgtcttccagtgcatcaccatggaagggtggaccaca
gtcctgtacaataccaatgatgccttaggagccacctggaactggctgtacttcatcccc
ctcatcatcattggatccttctttgtcctcaaccttgtcctgggagtgctgtcaggagag
tttgccaaagagcgtgagcgagtggagaaccgccgagccttcatgaagttgcggcgccag
cagcagatcgagcgggaactcaacggctaccgggcctggatagacaaagcggaggaagtc
atgctggctgaagagaacaaaaatactgggacctcagccttagaagtgctcaggcgagcc
accatcaaaaggaaccggacggatgccatgaaccgtgactcaagtgatgagcactgtgtc
gatatctcctccgtgggtgagcggaggctggcgcagagaagacctcttcatccaaccttg
ggtaaccccttgagtcactctggcctcaaaggtgccagagtggacggtgcctcatactta
cggcacaaggagcgactcctgcgcatctctgttcgccatatggtgaaatcccaggtcttc
tactggatcgtcttgagcctggtggctctcaacactgcctgtgtggccatcgtccatcac
aaccaaccagcctggctcacccacttcctctactatgcagagttcctgtttcttgggctc
ttcctcctagagatgtccttaaagatgtacgggatggggccacgtctttacttccattct
tcattcaactgctttgactgtggggtcacagtgggaagcatctttgaagtggtttgggct
atcttcaggccaggaacctcttttgggatcagtgtcctacgagcccttcgtctcctgcga
atatttaaaataactaagtactgggcatccctgaggaatttggtggtctcactgatgagc
tccatgaagtctattatcagcctcctcttcctcctcttcctcttcattgtagtctttgct
ctgctgggaatgcagctgtttggaggcaggtttaacttcaacgatgggacgccatcggcc
aacttcgacactttccctgcagccatcatgacagtgttccagatcctgacaggtgaggac
tggaacgaggtgatgtacaacggcatccgctcccagggaggcgttcgctcaggcatgtgg
tcctccatctatttcatcgtcctcaccttatttggaaactatactctgctgaatgtgttc
ttggccattgcggtggacaacctggccaatgctcaggagctcaccaaggatgagcaggag
gaagaggaggcctttaaccagaagcacgcccttcagaaagccaaagaagtcagccctatg
tctgccccaaatatgcctgctatcgaaagagacaggcgaaggagacaccacatgtcgatg
tgggagccacgcagcagccacctgcgggagcgtcgccggcggcaccacatgtcagtgtgg
gagcagcgcaccagccagctgcgccggcacatgcagatgtccagccaggagggcatcaac
aaggatgagccacccctcatcaacccccatgccagcatcttccgcaggaagaaaccaggg
gacggtgttgccctggaaaaatgtgctgaggagcagggtggcaagggtgagcggctgccg
gccgagggacctgagcagccagcctcaggagccaaccctggcggtggtgaggccaggagg
accccatcaccccgggccaagcgagacaaggagctgtggcaccagaaatcgtgccatggg
aactgtgagctgggtgagcaggacggggcaggaggcggcatcgaggataaggccaggatg
aggcagagccagaggcgcagccggcaccgcagagcccggatggaggggaaggagccaact
agtgcccttggaagccgctcagccagccaggagatgggtctggaggaggccagcaccaca
gtggggacgcaggatggggaccagcgtggggatgcagctgcagcggaggccttgattcag
ggggagatggaggccagcggggagcccatcaggacaaacggggtccctgccagtgaggct
gagctggttgggactgctgaggagggcagctccccgcaagcagcacctgagccccaccag
gggaagataggcagcctgacagaacaggactgcagcagcccagacaccagcgagcaagcg
ctgctggaggctagccgcaccgtcagccggagtgagcctgacctctcatccatcaccccc
aacactgagaaggccacggagagcaccaccataatgatcgatgtccacgactctgctgtg
gtacagattagcaacaagactgatggcgaagccagccccttaaaggaggctgaaaccaaa
gaggatgaggaggagatggagaagaagaagcggaagaaggagaaaagcgagacgggcaaa
gcaatggtcccacacagctccatgttcatcttcagcaccaccaacccggtgcggagggct
tgccactacatcgtgaacctgcgctacttcgagatgtgcatcctcctggtgatcgccgcc
agcagcatcgccctcgcggcagaggatcccgttctcaccaactccgaccgcaacaaagtc
ctgaggtattttgactatgtcttcaccggtgtcttcacctttgagatggttatcaagatg
atcgatcagggcttgatcctgcaggatggctcctacttccgagatctctggaacatcctg
gatttcatcgtggtggtaggagcgctggtggctttcgccttggcgaatgctttggggacc
aacaagggccgggatatcaagaccatcaagtctctccgtgtgctacgagtcttgagacca
ctgaaaaccatcaagcgactgcccaagctgaaggctgtctttgactgcgtggtgacttcc
ctcaagaacgtcttcaacatcctcattgtctacaagcttttcatgttcatctttgctgtc
attgccgttcagctcttcaaggggaagtttttctactgcactgacagctctaaggacaca
gagaaggactgcatagggaactacgtggaccatgagaaaaacaagatggaagtgaagtgc
agggaatggaaacgccatgagtttcactatgacaatatcatctgggctttgcttaccctg
ttcacagtctccactggcgagggttggccccaggtgctgcagcattcagtggatgtgacg
gaggaggaccgtgggcccagtcgcagcaaccgcatggagatgtccattttttatgttgtc
tattttgtggtctttcctttcttctttgtcaatattttcgtggctctcatcatcattaca
ttccaagagcaaggggacaaaatgatggaggagtgcagtctggagaagaatgagagggcc
tgtattgactttgccatcagcgccaagcccctcacacggtacatgccccagaaccggcac
acctttcagtaccgagtctggcactttgtggtctccccatcctttgagtacaccatcatg
gccatgatagcgttgaacaccgtcgtgctgatgatgaagtactactctgctccatacacc
tatgagctggccctgaagtacctgaacatcgcatttaccatggtgttctccttggagtgt
gtcctcaagatcatcgcttttggcttcctgaattatttccgggacacctggaacatcttt
gacttcatcacagtcatcggcagcattacggagatcatcctgacagacaccaagcttgtg
aacaccagcagcttcaatatgagcttcttgaagctcttccgggctgctcggctcatcaag
ctgctgcgccagggttacacgatccgcatcctgctctggacattcgtgcagtccttcaag
gccctcccctacgtctgcctcttgattgccatgcttttcttcatctacgcgatcattggg
atgcaggtttttggcaatatcaaactagatgaggaaagccacattaatcggcacaacaac
ttccgcagcttcctgggctccctaatgctcctcttcaggagtgccacaggtgaggcatgg
caggagatcatgctgtcctgcctggagggcaaaggctgtgagccagacacgacggcaacg
tctgggcagaatgagaacgagcgctgcggcactgacctggcctacgtttactttgtctcc
ttcatcttcttctgctctttcctgatgctcaacctgttcgtggcagtcatcatggacaat
tttgaatacctgactcgggattcctccatcctgggacctcaccatctagatgagtttgtc
cggatctgggcagagtatgacagagcagcgtgtggccgaatccattacactgagatgtat
gaaatgctgactcttatgtcaccaccgctaggcctcggcaagagatgtccttccaaagtg
gcctataagagactggtgctgatgaacatgcccgtggccgaggacatgacagtccatttt
acctccaccttgatggcactgatacgcacggccttggacatcaaaattgccaaaggtggt
gcagattggcagcagttagactctgagcttcaaaaggagatcctgactatttggcctcac
ctgtcccagaagatgcttgacctgttggtacccatgccaaaaacctctgacctgactgtt
ggcaaaatatatgcagccatgatgatcatggattactacaagcagagcaaagcaaagaag
cagcggcagcagctggaggagcagaaaaacgcccccatgtttcagcgcatggagccatcc
tccttgccgcaggaaatcatctcaaacgcaaaggctctgccttacctccagcaagacacg
ctctcgggcctgagcagccgaagtgggttcccctcactgagtccgctctcgccgcaggag
atcttccagctggcatgcatggatccggcccacgggcagttccaggagcaccagtctctg
gagccagaggttagggagtttcaaagagtgcagccctctaaccatggcagctaccttccc
gtggacactcaggaccacgctgtatctgggagggcctcctccatgcctcgtctcactgtg
gatccccaggtggtgacagacaccagctcaatgcggcgatcattttccaccatccgggac
aagcgccccaacagctcctggctggatgagttctccatggagcgcagcagtgacaacacc
tacaagtcccgccggcgcagctaccactcctcgctccagctctctgcccggcgcctcaac
agtgactcgggccaccggtccgacgggcatcgctcaggtggcagggagcggggccgatcc
aaagagcgcaagcacttgctgtcccccgatatctcccgctgcaactcagaggagaggagt
ccccaggcacacgacgagtcaccggagcggcggcgcgagtcccggtcacccagcgagggc
agatcacagacacccaacaggcagggaacgggctccctgagtgaaagctccatcccctcc
atctcggacaccagcaccccccggcgaggccgccgccagctcccgccagtgccccccaag
ccgcgtcccctcctctcctatgcctccatgctgcggcatgccggagacacctcaccaccc
ccagatgagagtgagggggggtccccgcccaacaccgccggccagaccgagtcttccagc
tcaccagtggggaagcagagccgacagtccaccccgcaacgttacatctcggagccgtac
ctggccctgcacgacgactcgcacgcctcagactgcggtgaggaggaaacactcaccttc
gaggcggccgttgccaccagccttggccgctccaacaccatcggctcggccccaccgctg
cggcacagctggcagatgcccaacgggcactaccggcggcggaggcgaggggcagggcag
ggtgtgatgtgcggggccagcatcgatgtgctcagtgacaccgaggaagacgacaagtgc
tag

DBGET integrated database retrieval system