KEGG   Athene cunicularia (burrowing owl): 113482753Help
Entry
113482753         CDS       T05777                                 

Gene name
PRKACB
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun04010  MAPK signaling pathway
acun04020  Calcium signaling pathway
acun04114  Oocyte meiosis
acun04140  Autophagy - animal
acun04261  Adrenergic signaling in cardiomyocytes
acun04270  Vascular smooth muscle contraction
acun04310  Wnt signaling pathway
acun04340  Hedgehog signaling pathway
acun04371  Apelin signaling pathway
acun04530  Tight junction
acun04540  Gap junction
acun04910  Insulin signaling pathway
acun04912  GnRH signaling pathway
acun04914  Progesterone-mediated oocyte maturation
acun04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:acun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113482753 (PRKACB)
   04310 Wnt signaling pathway
    113482753 (PRKACB)
   04340 Hedgehog signaling pathway
    113482753 (PRKACB)
   04371 Apelin signaling pathway
    113482753 (PRKACB)
   04020 Calcium signaling pathway
    113482753 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113482753 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    113482753 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    113482753 (PRKACB)
   04540 Gap junction
    113482753 (PRKACB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    113482753 (PRKACB)
   04912 GnRH signaling pathway
    113482753 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    113482753 (PRKACB)
   04916 Melanogenesis
    113482753 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    113482753 (PRKACB)
   04270 Vascular smooth muscle contraction
    113482753 (PRKACB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acun01001]
    113482753 (PRKACB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:acun03019]
    113482753 (PRKACB)
   03036 Chromosome and associated proteins [BR:acun03036]
    113482753 (PRKACB)
Enzymes [BR:acun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     113482753 (PRKACB)
Protein kinases [BR:acun01001]
 Serine/threonine kinases: AGC group
  PKA family
   113482753 (PRKACB)
Messenger RNA biogenesis [BR:acun03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     113482753 (PRKACB)
Chromosome and associated proteins [BR:acun03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    113482753 (PRKACB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 113482753
NCBI-ProteinID: XP_026709593
LinkDB All DBs
Position
8
AA seq 398 aa AA seqDB search
MAAQKEVPCNQCTGTATALQRLEGFANRLFHRHSKSGAHEQRVALENESQHCSELAVLWD
KSMKEFLAKAKEDFLRKWESPPQNTAGLDDFERQKTLGTGSFGRVMMVKHKSTEQYYAMK
ILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEYSFKDNSNLYMVMEYVPGGEMFSHL
RRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVK
GRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVS
GKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFATTDWIAIYQRKVEA
PFIPKCRGPGDTSNFDDYEEEDIRASLTEKCAKEFADF
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcagctcagaaggaggtaccttgtaaccagtgcacagggacggccacagcgctgcag
aggctggaaggttttgctaatcgccttttccataggcattcaaagagtggtgcacatgaa
cagagagtggctctggaaaatgagagccaacattgctctgaacttgccgtcctatgggac
aaatcaatgaaagagttcctagcaaaagccaaagaagactttttaagaaaatgggaaagc
ccccctcagaatactgctggcctagatgattttgagaggcaaaaaacgcttggaacggga
tcatttgggagagttatgatggtgaaacataaatccacagaacagtattatgctatgaag
atactggacaaacagaaggtcgtcaaactgaagcaaatagaacacacactgaatgagaag
agaatattacaagcggtgaattttcctttcctcgtaaaactggagtattcttttaaggac
aattctaatttatacatggtaatggagtatgttcctggtggcgaaatgttttcacatcta
agaagaatcggaaggttcagtgaaccacatgcacggttttatgcagctcagatagtgcta
acatttgagtacctccattcattagacctcatctacagagatctaaagcctgaaaatctt
ttaattgatcagcaaggatacatccaggtcacggattttggctttgcaaaaagagtaaaa
ggaagaacttggacgttatgtgggactccagaatacctggcacctgaaataattctcagc
aagggttacaacaaggcagtggattggtgggcattaggagtgttaatctatgaaatggca
gctggatatccccccttctttgcagatcagcccattcaaatttatgagaagattgtgtct
ggcaaggtaaggttcccatcacacttcagttcagacctaaaggatcttctaagaaattta
ctccaggtagatttgaccaaacgatacggaaatctcaagaatggtgtaaatgacataaag
aatcacaagtggtttgcaactacagattggattgccatttatcagagaaaggtagaagct
ccattcataccaaagtgcagaggccctggagataccagcaactttgatgactatgaagaa
gaagatattcgtgcgtctctaacagaaaaatgtgcaaaagaatttgctgatttttag

DBGET integrated database retrieval system