KEGG   Athene cunicularia (burrowing owl): 113486045Help
Entry
113486045         CDS       T05777                                 

Gene name
GALNT9
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9 isoform X1
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun00512  Mucin type O-glycan biosynthesis
acun01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acun00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    113486045 (GALNT9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:acun01003]
    113486045 (GALNT9)
Enzymes [BR:acun01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     113486045 (GALNT9)
Glycosyltransferases [BR:acun01003]
 O-Glycan biosynthesis
  Mucin-type
   113486045 (GALNT9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 113486045
NCBI-ProteinID: XP_026715471
LinkDB All DBs
Position
15
AA seq 604 aa AA seqDB search
MAVARKIKTLLTVNILVFVGIILFSVYCRIQDRSQELVQIVRSADRRARSRGAKVGSLAD
RESILQRLDHLEEVVYNQLNGLAKPMGLVEGPGGLGQGGMAATLRDDSHESETKYEEYGY
NAQLSDRISLDRSIPDYRPKKCKQMTYPDDLPQISVVFIFVNEALSVILRSVHSVVNHTP
SHLLKEIILVDDNSDNVELKFNLDQYVNKRYPGLVKIVRNNKREGLIRARIQGWKAATSP
VVGFFDAHVEFNIGWVEPALTRIKEDRKRIILPAIDNIKYNTFEVQQYANAAHGYNWGLW
CMYIIPPQDWLDKGDESAPIRTPAMIGCSFVVDREYFGEIGLLDPGMEVYGGENIELGMR
VWQCGGSMEVLPCSRVAHIERTKKPYNNDIDYYAKRNALRAAEVWMDDFKSHVYMAWNIP
MANPGVDFGDVSERIALRQRLQCRSFKWYLENVYPEMRVYNNTVTYGEVRNSKASGYCLD
QGAEEDDKAILYPCHGMSSQLVRYSSEGVLQLGPLGSTAFLPDSKCLVDDGKGRTPTLKK
CEDVLRPAQRFWDFTQNGPIISRDTGRCLEVEMSKDANFGLRLVVQRCSGQKWMIRNWIK
HGRH
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggcacggaaaatcaaaactttgttgacggtgaacatcttggtcttcgtgggc
atcatcctcttctccgtgtactgcaggatccaggaccgctcccaggagctggtgcagatc
gtccggagcgcggaccgccgggccaggagccgcggcgccaaggtgggcagcctggccgac
agggagtccatcctgcagcgcctggaccacctggaggaggtggtctacaaccagctgaat
ggtctggcaaaacccatgggattagttgaaggtccaggaggcttgggccaggggggaatg
gctgctaccctgagagatgatagtcatgaatcagagactaagtatgaagaatatggttac
aatgcccaactgagtgacaggatatcactggacaggtccatccctgactacagaccaaaa
aagtgcaaacagatgacctatccagatgacctgccccagatctctgtcgtctttatattt
gtaaacgaggcactctcagtcatcctgcgctctgtgcacagcgttgtgaatcacacccca
tcacacttgctcaaggagatcattctggtggatgacaacagtgacaatgttgagctaaaa
tttaatctggaccagtatgtcaataaaagatatccaggtctggtgaaaatagtgcgcaat
aacaaacgagaaggactgattcgagccagaatccaaggctggaaagcagcaacctctcct
gtcgttgggttctttgatgctcacgttgagttcaacattggctgggtggaacctgcactt
acccggatcaaagaagatcgaaagcggatcatcttaccagcgattgacaatatcaagtac
aacacttttgaagtgcagcaatacgccaatgcagcccacggctataactggggcctctgg
tgcatgtacataatcccaccgcaggactggctcgataaaggggatgagtcagctcccatc
aggacaccagccatgattggatgctcgtttgtagtggaccgagagtattttggtgagatt
ggcttgcttgaccctggtatggaggtttatggaggagaaaacatcgaattaggcatgagg
gtctggcagtgtggaggaagcatggaggtgttaccctgttctcgcgtggcacatattgaa
cgcacaaagaaaccctacaacaacgacatcgattactatgcaaagcgcaacgccctgcgg
gcggccgaggtctggatggatgatttcaagtcgcatgtttacatggcgtggaacatcccc
atggcaaaccctggagttgactttggagacgtttctgaaagaatagctctacgacagcga
ctgcagtgccggagttttaagtggtacttggagaatgtctatcctgaaatgagggtttat
aataatacagtcacttatggagaggtgcgtaacagcaaagctagtggctactgcttagat
cagggagccgaagaggatgacaaagcaatcctttatccatgccatggaatgtcctctcag
cttgtccgctacagctcggaaggcgtcctgcagctggggccgctgggctccacggccttt
ctgccggactccaaatgcctcgtggacgatgggaagggcaggacaccgactctgaagaag
tgtgaagatgtgctgaggccagcgcagaggttctgggatttcacacagaatggcccaatc
atcagcagagacactggccgttgtctagaagtggaaatgtcaaaggatgcaaattttggg
ctcagattagtggtacaaaggtgctcggggcaaaaatggatgattagaaactggataaaa
catggccgacattga

DBGET integrated database retrieval system