KEGG   Athene cunicularia (burrowing owl): 113486525Help
Entry
113486525         CDS       T05777                                 

Gene name
CARD9
Definition
(RefSeq) caspase recruitment domain-containing protein 9 isoform X1
  KO
K12794  caspase recruitment domain-containing protein 9
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun04621  NOD-like receptor signaling pathway
acun04625  C-type lectin receptor signaling pathway
acun05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:acun00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    113486525 (CARD9)
   04625 C-type lectin receptor signaling pathway
    113486525 (CARD9)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    113486525 (CARD9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD
Motif
Other DBs
NCBI-GeneID: 113486525
NCBI-ProteinID: XP_026716348
LinkDB All DBs
Position
17
AA seq 544 aa AA seqDB search
MLEEDSDETCWNNLENFRVKLISVIDPSRITPYLRQCKVISHDDEEQVLNDPTLVMRKRK
AGVLLDILQRTGHKGFEAFLESLELYYPQLYKKITGKEPSRVFSMIIDTAGESGLSQLLM
NEIMKLQSTVQEERRKAQELTMWLHTKEDTIKEMWVRDSLLRKHQERAQKMKEERDSLSK
ELRKCKDENYNLAMSYAKQSEEKSAALMKNRDLILEIDHLKHSLMKAEDDCKLERKHTMK
LKHAIEQRPSHEVMWEIQQEKELLLAKNQELQNTLQVAREQSLEKSLSSKTLENDCSQIL
EERQELMNTIYSLRKELRQAEVLRDKYAEEKEMLELQCTSLRKDSQMYKKRIEAVLQQME
EVASERDQALLTREQFYMQYSKNLVERDAHRKQIRELGERCDELQLQLFQKESQLLATEA
KLKRLQLELPTLTSDLDDTSSRDSQEITLHSHLDEDTKPPKKDCPEGQNQQFSTRESSLP
PKSPSFKECGLANEELAEKERRRMKDCFERYRRKRALRRILKGRHHEADWENTTGSDNTD
TEGS
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgttggaagaagatagtgatgagacgtgttggaataacctggagaacttccgggtgaag
ctgatctctgtgatcgatccttcccgtataacgccctatcttcgccagtgcaaagtgatc
agccacgatgatgaggagcaagttcttaatgaccccaccctggtcatgcgcaaacggaag
gcaggtgttcttctggacattcttcagcgaacgggacacaagggctttgaggcatttctg
gagagtcttgaactttattatccacagctgtataagaaaataactggcaaggagcccagc
agggttttctctatgattatagacactgctggggaatctggcctgagccagctcctgatg
aatgagatcatgaagctgcagagcaccgtgcaggaggagcggcggaaggcccaggagctc
accatgtggctgcacaccaaagaggacacgatcaaagagatgtgggtgagggacagcctg
ctccgcaagcaccaagagcgggcgcagaagatgaaggaggagagggacagcctgagcaag
gagctgcggaagtgcaaggacgagaactacaacctggcaatgagctacgccaaacagagc
gaggagaagagtgctgccctcatgaagaatcgggacctgatcctagagatcgatcactta
aagcacagcctcatgaaagctgaggatgactgcaaactggagcgtaagcacacgatgaaa
ctgaaacatgccatagagcagcgtccaagccatgaagtgatgtgggagatccagcaggag
aaggagttgctcttggccaagaaccaggagctgcagaacactctccaggttgccagggaa
cagagtttggagaagagcctctccagtaagactctagagaatgactgtagccagatacta
gaagaacgccaggagctgatgaacaccatttacagccttcgcaaggagctgcggcaagcc
gaggtgctccgtgacaaatatgcagaggagaaagagatgcttgaactacagtgcacgtct
ctgaggaaggactcccagatgtataaaaaacggattgaagctgtcttgcagcagatggag
gaagtggcttcagaaagagaccaggcgctcctgacccgagaacagttctatatgcagtac
tccaagaacctggttgagagggacgctcaccgcaagcagattcgggaactgggggagcga
tgtgacgaactgcaactgcagctcttccaaaaggagagtcagttactggctactgaagcc
aagctgaaaaggttgcagctggagctgcccacactgacctctgacctggatgatacctcc
tctagagattcccaggaaattactcttcacagtcatctagatgaagatacaaaaccgcct
aaaaaagattgccctgaaggacaaaaccagcaattcagcactcgagagagcagtctgcct
ccgaagtcacccagtttcaaggagtgtggtttagccaatgaggaactggcagaaaaggag
cggaggaggatgaaggactgctttgagcgttaccgaagaaaaagagcactgcgaagaata
ctgaagggccgacaccacgaggcagactgggagaacaccactggcagcgacaacactgac
actgaaggctcctga

DBGET integrated database retrieval system