KEGG   Athene cunicularia (burrowing owl): 113487124Help
Entry
113487124         CDS       T05777                                 

Gene name
GALNT17
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 17
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun00512  Mucin type O-glycan biosynthesis
acun01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acun00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    113487124 (GALNT17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:acun01003]
    113487124 (GALNT17)
Enzymes [BR:acun01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     113487124 (GALNT17)
Glycosyltransferases [BR:acun01003]
 O-Glycan biosynthesis
  Mucin-type
   113487124 (GALNT17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin RicinB_lectin_2 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 113487124
NCBI-ProteinID: XP_026717338
LinkDB All DBs
Position
19
AA seq 598 aa AA seqDB search
MASLRRVKVLLVLNLIAVAGFVLFLAKCRPITAKNGDSFHDIHPRAEVANLTAHGISSIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPEEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKELKYGKDLPQISIIFIFVNEALSVILRSVHSAVNHTP
AHLLKEIILVDDNSDEEELKAPLEEYVNKRYPGLVKVVRNQKREGLIRARIEGWKVATGQ
ITGFFDAHVEFTAGWAEPVLSRIQENRRRVILPSIDNIKQDNFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVHRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNNNIGFYTKRNALRVAEVWMDDYKWHVYIAWNLP
LENPGIDIGDVSERKALRKSLKCKNFQWYLDHVYPEMRRYNNTIAYGELRNNKAKDVCLD
QGPQENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNVKSRFPQLLD
CEKVKSSLHKRWSFIQNGAILNKGTGRCLEVENRGMAGIDLILRSCTGQRWTIKNFIK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcttctttgaggagagtcaaagtcctgctggtgttaaacttgatcgcggtggctggc
ttcgtgctcttcctggccaagtgcagacccatcacggccaagaacggcgactccttccat
gacatccatcccagggcagaagtggccaacttgacagcccacggcatcagctccatccag
gacgcagtgctgaagagactctccctcctggaagatatagtctaccggcagctgaacggt
ctgtccaagtcactcggtctcattgaaggctatggtggacgtggtaaaggtgggcttcca
gccaccctgtctcctgaggaggaggagaaagcaaagggaccacatgagaaatacggctac
aactcctacctcagtgagaaaatttcgctggatcgttccataccagattatcgtccaacc
aagtgcaaagagctgaaatatggcaaggacctaccccagatctccatcatcttcatcttc
gtgaatgaagcactctccgttatcctgcggtcagtgcacagcgctgttaatcatacgcca
gctcacctcctgaaggagattatccttgtggatgacaacagtgatgaagaggaactgaag
gcgccgctggaagaatacgtcaataaacggtatcctggcctcgtgaaggtggtgcgcaac
cagaagagggagggtcttatccgagctcgtattgaaggctggaaagttgccactggccag
atcactggatttttcgatgctcatgtggagttcactgctggctgggctgagccggtactt
tcacgaattcaggaaaatcggagaagggtgattcttccctccatagacaacatcaagcag
gacaactttgaggtgcaacgttatgagaactctgcccacgggtacagctgggagctgtgg
tgcatgtacatcagcccccccaaggactggtgggatgccggagacccctcactgcccatc
aggacaccggcaatgatcggatgctcatttgttgtgcacagaaaattctttggagagatt
gggcttctcgatcctgggatggatgtgtacggaggggagaacatagagctcggcatcaag
gtgtggctgtgcggcggcagcatggaggtcctgccctgctccagggtggctcacatcgag
cgcaagaagaagccctacaacaacaacattggtttttacactaagcgcaatgctctgcgg
gtagccgaggtgtggatggatgactacaaatggcacgtctacatcgcatggaacctgccg
ctggagaatccaggtattgacattggggatgtttctgagagaaaagcgttaaggaagagc
ttgaagtgtaaaaatttccagtggtatctggaccacgtttatccggaaatgagaagatac
aacaacaccattgcttatggagagcttcgaaacaacaaggcaaaagatgtctgccttgac
cagggcccacaggagaaccacacggcaatattgtacccgtgccatggctggggaccgcag
cttgcacgctacaccaaggagggattcctacatctcggtgcccttgggaccacgactctt
ctacctgatacccgctgcctggtggataacgtgaaaagccgcttccctcagctcctcgat
tgcgagaaggtcaagagcagcctccataagcgctggagtttcatacagaatggtgccatc
ctgaacaagggaacgggacgatgcttggaagtggagaacaggggaatggctggcattgat
ctgattcttcgcagctgcacgggacaaaggtggacgattaaaaatttcatcaagtaa

DBGET integrated database retrieval system