KEGG   Athene cunicularia (burrowing owl): 113487958Help
Entry
113487958         CDS       T05777                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun00020  Citrate cycle (TCA cycle)
acun00190  Oxidative phosphorylation
acun01100  Metabolic pathways
acun01200  Carbon metabolism
Module
acun_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
acun_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:acun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    113487958 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    113487958 (SDHB)
Enzymes [BR:acun01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     113487958 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer2 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 113487958
NCBI-ProteinID: XP_026718722
LinkDB All DBs
Position
21
AA seq 260 aa AA seqDB search
MLGQICRGVQTAAAVAPRIKKFAIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIK
NELDSTLTFRRSCREGICGSCAMNIAGGNTLACIKRIDPDLNKITKIYPLPHMYVVKDLV
PDLSNFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECILCACCSTSCPSYW
WNGDKYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNPG
KAIAEIKKMMATYKEKATAA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgttagggcagatatgtcggggagtgcagacagcagctgcggtggcgccccgtatcaag
aagtttgccatctacagatgggatcccgacaagcctggggacaagccccgcatgcagaca
tatgaagtggatttgaataaatgtgggcctatggtgcttgatgctctgatcaagattaaa
aatgagttggactccactctgaccttccgcagatcatgtagggaaggcatctgtggctct
tgtgctatgaacattgcaggtggaaacacactggcctgtatcaaaagaattgaccccgat
ctcaacaagatcactaaaatctaccctctcccccacatgtatgtggtgaaagaccttgtt
cccgacttgagtaacttctatgcacagtacaaatctatcgagccttacctgaagaaaaag
gatgagtcgaaacagggcaaggagcagtacctgcagtccatagaagaccgtcagaaactg
gacggactctacgagtgcattctgtgtgcctgttgcagcaccagctgccccagttactgg
tggaatggggacaagtacttgggtcctgcagtattgatgcaggcctatcgctggatgatt
gactccagagatgactacacagaggaacgcctggcacagcttcaagacccattttctctc
taccgttgtcacactatcatgaattgcacaaggacttgccctaagggtttgaaccctggc
aaagcaattgctgagatcaagaagatgatggcaacttacaaagagaaggcaactgctgca
taa

DBGET integrated database retrieval system