KEGG   Athene cunicularia (burrowing owl): 113488119Help
Entry
113488119         CDS       T05777                                 

Gene name
NKX3-1
Definition
(RefSeq) homeobox protein Nkx-3.1
  KO
K09348  homeobox protein Nkx-3.1
Organism
acun  Athene cunicularia (burrowing owl)
Brite
KEGG Orthology (KO) [BR:acun00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:acun03000]
    113488119 (NKX3-1)
Transcription factors [BR:acun03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, NK-2
    113488119 (NKX3-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 113488119
NCBI-ProteinID: XP_026718940
LinkDB All DBs
Position
22
AA seq 248 aa AA seqDB search
MSAGVLRARKPRSPSSTPAGMSWTPTAAQQSRPMFSRPRTSFLIQDILWDGAERGARPER
GRSGGFGSPEDGEPGVTPTEGSEGSSAPGAAPVHPPRSPCSPGASQGRGTPHEADTDAYL
SECDPPLQHLPVTQCPPKQAKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLQLT
ETQVKIWFQNRRYKTKRKQVASEISGLDTRLPGQKAAALPGASLLALRAGWQHLPYLYYL
NGWSPSWW
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagtgccggggtgctccgcgcaaggaagccgagatcacccagcagcaccccagcaggg
atgagctggaccccaacagcagcccagcagagcaggcccatgttctccaggccccggaca
tcattcctcatccaagacatcctctgggatggggcagagcggggagcgcggccggagcgg
ggcaggagcggagggtttggcagcccagaggacggggagcctggggtgaccccgacggag
gggagcgagggcagctcggccccgggggctgccccagtgcacccccccaggagcccttgt
tccccaggagcatcgcaaggccgagggacaccccacgaggcggacacagatgcctacctg
tccgagtgtgacccccccctgcaacacctgcccgtcacccagtgcccccccaagcaggcg
aagcgctcgcgggcggctttctcccacacccaggtcatcgaactggagcgcaaattcagc
caccaaaaatatctgtcggcccccgagcgagcccacctggccaaaaacctccagctcact
gagacccaggtgaaaatctggttccagaacaggagatacaaaaccaagaggaaacaggtc
gcttccgaaatcagcggactggacacgcgcctgcccgggcagaaagcggctgcgctgccc
ggagcgtcgctgctggcactacgggcgggctggcagcacctgccttacctctactacttg
aacggctggagtccctcctggtggtaa

DBGET integrated database retrieval system