KEGG   Athene cunicularia (burrowing owl): 113488476Help
Entry
113488476         CDS       T05777                                 

Gene name
HDAC10
Definition
(RefSeq) histone deacetylase 10 isoform X1
  KO
K18671  histone deacetylase 10 [EC:3.5.1.98]
Organism
acun  Athene cunicularia (burrowing owl)
Brite
KEGG Orthology (KO) [BR:acun00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:acun03036]
    113488476 (HDAC10)
Enzymes [BR:acun01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     113488476 (HDAC10)
Chromosome and associated proteins [BR:acun03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     113488476 (HDAC10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 113488476
NCBI-ProteinID: XP_026719447
LinkDB All DBs
Position
1
AA seq 681 aa AA seqDB search
MASGTALIYDEEMTTHKLLWSDPVCDIEVPERLSSSYEQLKRYHLVERCVRVPVREGSEE
EILLVHSSEHLEVAKSTQTMNEEELKRVSGNYDAFFFHQNTYRCARLAVGATLQLVDAVM
SGKVCNGMALVRPPGHHSQRNAANGFCLFNNVAIAAEYAKLKYGLKRILIVDWDVHHGQG
TQYIFEEDPSVLYFSWHRYEHQEFWPSLRESDYDAVGLGKGKGFNINLPWNKVGMGNSDY
LAVFFHVLLPVAFEFDPELVIVSSGYDSGIGDPEGQMNATPEVFAHLTHFLMQLANGKLC
VILEGGYHLKSLSESVCMTVKTLLGDPIPEITGEMAPCLSAVESIQNVRAAHKPYWKWLM
YEDTSFIQNLSTKSHTLKKADPSPSTEHESKISNNNETVKVEKFLELHMKNILFPVPHIR
TATSDSKGSAHLLPVPVHLVKELDKTEIKAFVSGFYADLVKEDKTLLSLGSMLAILDKIL
KKEVCNGIAQSPTASVSVAVALRHSVRFGFQRVLCVFVGDMQIIPNTDDGKILMIHICEK
EQSGKTSSKHYIPLNWKQDAEGNDFFSAVLGFILPVAYSYRPDLTVIGIGPNRSLGISGI
FLLFTLLQGLAESRILAVIEDKEINLMQSIAKALVGASTPNFGTYIPPSQEKANKIKILR
DQFQQQWKMLQYSVTEGISRN
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaggaacagcactgatttacgatgaggagatgaccactcataaactactttgg
agtgatcctgtttgtgatattgaagtgccagaaagactgtcatcctcctatgagcagctt
aaacgttaccatcttgtggaaagatgtgtccgtgtacctgtcagagaaggaagtgaggag
gagatcctgttagttcacagttcagaacacttggaagtggcaaaaagcacacagacaatg
aatgaagaggaactgaaaagagtctctggaaattatgatgcttttttttttcatcagaac
acttaccgctgtgccagactagcagtaggagcaactttgcagctggtggacgctgtgatg
tcaggaaaagtgtgcaatggaatggcattagtaagacctccaggtcaccacagccagaga
aatgcagctaacgggttctgtttgtttaacaatgttgctattgcagcagaatatgcaaaa
ctgaaatatggtctaaagagaatcctaattgttgactgggatgtgcaccacgggcaagga
actcagtatatatttgaagaagatccaagtgttttgtatttttcctggcatcgctatgaa
catcaggaattctggccatcactcagagagtctgattatgatgctgtgggtctaggaaaa
ggaaaaggtttcaacataaatttgccttggaataaggttgggatgggaaattcagattat
cttgctgtgtttttccatgtgttgcttccagtggcttttgagtttgatccggaactggtt
attgtttcctctggatatgattctggaattggagaccctgaaggtcagatgaatgccact
cctgaggtttttgcccaccttacccacttccttatgcagttagctaatggaaagctgtgt
gtcatcctagagggtggttaccacttaaagtcattgtctgaatcagtctgcatgactgta
aaaactttgcttggagatcctatacctgaaataactggagaaatggcaccttgcctaagt
gctgttgaatctattcaaaacgtgagagcagcacataaaccctactggaaatggttgatg
tatgaagatacatcatttatacaaaatttgagcaccaaatcgcacacactaaagaaggct
gatccaagtccctccacagaacatgaatctaagataagtaacaacaatgaaactgtcaaa
gtagaaaagtttttggaactgcacatgaaaaatattctatttccagtgcctcacatcaga
acagcaacatctgactctaaaggttcagcacatttgctccctgtacctgttcatttggtg
aaggaattggacaaaactgaaataaaagcttttgtcagtggcttttatgcagaccttgtg
aaagaggacaaaactttgctctctcttggcagtatgttggccatcctagataaaatactt
aagaaggaggtgtgcaatgggattgcacagtcacccacagcttctgtttctgttgctgtt
gcactaagacattctgttcgctttggatttcaaagagtactttgtgtatttgttggagac
atgcaaatcataccaaacacagatgatgggaaaatactcatgatacatatttgtgagaaa
gagcagtctggaaagaccagctccaaacactatattcctctaaattggaaacaggatgct
gaaggaaatgacttcttttctgctgtacttggattcattcttcctgtagcatatagttat
cgacctgacttgacagtaataggtattggaccaaacaggagccttggaataagtggaatt
tttctgctttttactttactacaaggattagctgagtctcgaattctagcagtgattgag
gacaaagagataaatttaatgcaaagtatagccaaagcattagtgggtgcttctacacct
aactttggaacttatatacctcctagccaagaaaaagcaaataaaattaaaatattaaga
gaccagtttcagcagcaatggaaaatgcttcagtattcagtaacggagggtatttcaaga
aattga

DBGET integrated database retrieval system