KEGG   Athene cunicularia (burrowing owl): 113488931
Entry
113488931         CDS       T05777                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun04012  ErbB signaling pathway
acun04068  FoxO signaling pathway
acun04110  Cell cycle
acun04115  p53 signaling pathway
acun04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:acun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    113488931 (CDKN1A)
   04068 FoxO signaling pathway
    113488931 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    113488931 (CDKN1A)
   04115 p53 signaling pathway
    113488931 (CDKN1A)
   04218 Cellular senescence
    113488931 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 113488931
NCBI-ProteinID: XP_026720165
LinkDB
Position
26
AA seq 193 aa
NPRCPSPRWVLADSLLWAALFPPWLLCAFLCSKCAGPWACLWLAQHPSNLLCFLPRCHGP
VDHHELQNEFEGMLKQHLEEARQRWNFDFETETPLEGQFKWERVLQAEQPPQEVHSLAKA
TSSESSSVHKVPAKIHRSRISPEYQQSLEIYRAASPLSLKRGLTTMKDFYSAKRRTVHNK
PKPDKPKPDKPRL
NT seq 582 nt   +upstreamnt  +downstreamnt
aatccccgatgtccgagtccaagatgggtgctggcggacagtctcctctgggctgccttg
ttcccaccttggctactgtgtgcttttctctgtagcaaatgtgctggcccttgggcctgt
ttgtggcttgcccaacaccccagtaacttgctctgctttcttcccaggtgccacggcccc
gtggaccaccacgagctccagaatgaatttgagggaatgttgaagcaacacctggaagaa
gctcggcagcgctggaactttgactttgagacggagactcccttggaaggacagttcaag
tgggagagggtcctccaggctgagcagcccccccaggaggtccacagcctggccaaggcc
accagcagtgagagctcctcggtccacaaggtccctgccaagatccatcgcagcaggatt
tcccctgagtatcagcagagcttggagatttacagggctgcttccccgctgagcctgaaa
cgggggctgaccaccatgaaagacttctacagcgctaagcggaggactgtccacaacaag
cctaagcctgacaagcccaagcctgacaaacccaggctgtga

DBGET integrated database retrieval system