KEGG   Athene cunicularia (burrowing owl): 113488977Help
Entry
113488977         CDS       T05777                                 

Gene name
RIBC2
Definition
(RefSeq) RIB43A-like with coiled-coils protein 2
Organism
acun  Athene cunicularia (burrowing owl)
SSDB OrthologParalogGFIT
Motif
Pfam: RIB43A Herpes_UL35
Motif
Other DBs
NCBI-GeneID: 113488977
NCBI-ProteinID: XP_026720234
LinkDB All DBs
Position
1
AA seq 362 aa AA seqDB search
GSRQERAPPQRLLRVCRHLRFQVDKDALDTQVKDRKIQEAAEKARNEELANEMKKNDKIM
CMLERQQKNDIRNINKAICEFQKNFQKPETRREFDLSDPEALKKDRPARLSDNDPRCTVS
GLQKFMGEDLNYNQRMKFQKEQLREWSLQQQRDWKNALADQKFADDLYDKNRIELDQKIM
EQQRREEENRRAVCAATKDFNRAQAAELAERRKLEKDQKMKDDMDEISSLLQGDLLSENP
EQAVSSFGRHRVIPDRWKGMNRDQLMAIRYSQQQQVLEKLRLKEEEDRRDAEWDRQNIQA
ARAQLVLEQHQQRQIRERRRALDTINAELSQEQKAKNIYLREEAYSNFPTGQYYAQFNTT
SR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
ggaagccgccaggagcgcgcgccccctcagcgcctcctcagggtctgccggcacctgcgg
ttccaggttgataaagatgccttggatacccaggtcaaggacaggaaaattcaagaagca
gctgaaaaagcacgaaatgaagaacttgctaatgaaatgaagaaaaatgacaagatcatg
tgcatgttagaacgacagcagaaaaatgatatcagaaacataaataaggctatctgtgaa
tttcagaagaattttcagaagccagaaacaagacgtgaatttgacctgtctgatccagaa
gccctaaagaaggacagacctgctcgactttcagacaatgatcctcggtgtaccgtatct
ggcttgcagaaatttatgggtgaagacttaaactataatcagaggatgaaatttcaaaag
gagcagttaagagagtggtctcttcagcaacagagagactggaagaatgcattagctgac
caaaaatttgcagatgatctttatgacaagaataggattgaacttgaccaaaagattatg
gagcagcaacgaagagaagaagaaaacaggcgtgctgtttgtgcagctactaaagatttc
aacagagcccaggctgctgaactagccgagagaaggaagttggaaaaagatcaaaaaatg
aaagatgacatggatgaaatttccagcctccttcaaggagatttactttctgaaaaccct
gaacaagcagtcagttcctttggtagacatcgtgtgatccctgatcgatggaaggggatg
aatcgggatcagctgatggcaatccgatactctcaacagcaacaagttctggagaaactg
agactaaaagaggaagaagaccgaagagatgctgagtgggacaggcagaatatacaggct
gcgagagcacagttggttttggagcagcatcagcaacgccagattcgggagcgccggcga
gctttagataccataaacgcagagctgtctcaggagcagaaagcaaagaacatttatctt
agagaggaagcatattcaaattttccaacgggccagtattacgcacagtttaatacaacc
agccgatga

DBGET integrated database retrieval system