KEGG   Athene cunicularia (burrowing owl): 113489073
Entry
113489073         CDS       T05777                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun04068  FoxO signaling pathway
acun04217  Necroptosis
acun04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:acun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    113489073 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113489073 (STAT3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    113489073 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:acun03000]
    113489073 (STAT3)
Transcription factors [BR:acun03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    113489073 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 Syntaxin-6_N AP1AR Fib_alpha
Other DBs
NCBI-GeneID: 113489073
NCBI-ProteinID: XP_026720387
LinkDB
Position
27
AA seq 892 aa
MVELQQLQPSAPGSGQQLPDTLAKPPHVWGSRGKRGGRAHRQAGDSAACCPACSPALPRP
LCQAPRPLPPPCRAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFL
QSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQATHPTAAVVTEKQQMLEQHLQD
VRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTAL
DQMRRGIVSELAGLLSAMEYVQKMLADEELADWKRRQQIACIGGPPNICLDRLENWITSL
AESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVXXPPCPS
AVALPEAVSRSRSASAALRRLLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTN
TKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGL
KIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSW
QFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIID
LVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGITFTWVEKDISG
TSLSLAARRVAAATPGASGPPAGPSLCVLVPTGPCLPDLSPSLDGDRVVRNSERSEALAA
ALVDAGSPGGVGPNPEFTQHNRIAKRIGVCEIQVMRRDEALIAPGDVLAGCPSPHPSKVC
GTSGLSGSAGGPAGGRKACAPDIPSPGSLRRLKLLLKELLSAGTSRSGCVGLVVSPPTVG
RSHHLPAPMVVVDQTHPLELARLVRECVTNFDLLFQLQPASRRIPLQNLQHP
NT seq 2679 nt   +upstreamnt  +downstreamnt
atggtggagctgcagcagctccagccctcggctcccggctcggggcagcagctgccggac
acgctggcgaagcccccccatgtgtgggggtccagggggaagcggggtggccgagctcac
cggcaggcaggggactctgctgcctgctgccctgcctgcagccctgccttgccccgtccc
ctgtgccaggcacccaggcctctgccccccccgtgcagggcgtacgctgccagcaaggag
tcgcacgccacgctggtgttccacaacctgctgggggagatcgaccagcagtacagccgg
ttcctgcaggagtccaacgtcctgtaccagcacaacctgcggcgcatcaagcagttcctg
cagagcagatacctggagaagccgatggaaatagcacgcatcgtggctcgctgcctgtgg
gaagagtcccggctcctccagacggctgccaccgcggcccagcaagggggacaggccacg
cacccgacagcagccgtggtgacggaaaagcagcagatgctggagcagcatctgcaagat
gtcaggaagagggtgcaggatctggagcagaagatgaaagtggtggagaatctccaggat
gactttgattttaactacaagactttgaaaagccaaggagacatgcaggatctgaatggg
aacaatcagtccgtgacccggcagaagatgcagcagctggagcagatgctcacggcgctg
gaccagatgcggagggggattgtgagcgagctggccggactgttgtcagccatggagtat
gtgcagaagatgctggcggatgaggagctggcggactggaagaggcggcagcagatcgcc
tgcattggcgggccaccgaatatctgcttggaccggctggagaactggatcacgtccctc
gcggagtcacagctacagacccggcagcagatcaagaagctggaagaactgcagcagaaa
gtgtcctacaagggcgaccccatcgtgcagcaccggcccatgctggaggagcggattgtg
gagctgttcaggaacctgatgaagagcgccttcgtcgtnnnnnncccgccgtgcccctca
gctgtggcgctgccggaggccgtgtcgcgctcacgctctgcgtctgctgctctccgcagg
ttgttggtcaagttcccagagctgaactatcagctgaaaattaaagtctgcatcgacaag
gactccggggacgtcgcagcgctgcgggggtcccggaagtttaacatcctggggacaaac
accaaggtcatgaacatggaggagtcgaacaacggcagcctctcggcggagttcaagcac
ctgaccctgcgggagcagcgctgcgggaacgggggcagagccaactgcgacgcctcgctg
attgtcaccgaggagctgcacctcatcaccttcgagacagaggtgtatcaccaggggctg
aagatcgacctggagacccactcgctgcccgtggtggtcatctccaacatctgccagatg
cccaacgcctgggcgtccatcctctggtacaacatgctgaccaacaaccccaagaacgtg
aacttcttcaccaagccccccatcgggacctgggaccaggtggcagaggtgctgagctgg
cagttctcctccaccacgaagcgcggcctcagcatcgagcagctgacgacgctggcagaa
aagctgctagggccaggtgtgaattactctggctgccagatcacctgggccaagttctgc
aaggagaacatggctggcaaaggcttctccttctgggtctggctggacaacatcattgac
ttggtgaaaaagtacatcctggcgctgtggaacgaagggtacatcatgggcttcatcagc
aaggagcgggagcgagccatcctgagcaccaagcccccgggaaccttcctgctgcgcttc
agcgagagcagcaaggagggcggcatcaccttcacgtgggtggagaaggacatcagcggt
acgtcgctgtccctcgctgcccggcgcgtggccgccgccactcccggggcctcggggccc
ccggccggaccctcgctctgtgtccttgtcccgacgggcccctgcctcccagacctcagc
ccctctttagatggtgaccgggttgtgcgtaattcagagcggtcagaggctctagcagct
gcgctggtggatgctggctctccaggaggagttggacctaatcctgagttcacacagcac
aaccggatagcgaagcgaattggggtctgtgaaatacaggtcatgcgaagagacgaagct
ctaatagcaccaggtgatgtgctggctggctgtccctcgcctcaccctagcaaggtgtgt
ggaacatccgggcttagtggaagtgctggagggcccgctggtgggaggaaagcttgtgct
cccgatatcccttctccagggagcctcaggaggcttaagctcctgctgaaggagctgctg
agtgcagggacctcccgctcaggctgtgtggggcttgtggtttcacctcctaccgtgggc
aggagccaccacctgcctgcgccgatggtggttgtggatcaaacccaccctctcgaactg
gctcggctggtccgtgagtgtgtcactaactttgacctcctcttccagttgcaacctgcc
tccaggaggatcccactgcagaacctgcagcatccttaa

DBGET integrated database retrieval system