KEGG   Athene cunicularia (burrowing owl): 113489137Help
Entry
113489137         CDS       T05777                                 

Gene name
ACE
Definition
(RefSeq) angiotensin-converting enzyme isoform X1
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
acun  Athene cunicularia (burrowing owl)
Brite
KEGG Orthology (KO) [BR:acun00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:acun01002]
    113489137 (ACE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acun04147]
    113489137 (ACE)
   04090 CD molecules [BR:acun04090]
    113489137 (ACE)
Enzymes [BR:acun01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     113489137 (ACE)
Peptidases [BR:acun01002]
 Metallo Peptidases
  Family M2
   113489137 (ACE)
Exosome [BR:acun04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   113489137 (ACE)
CD molecules [BR:acun04090]
 Proteins
  113489137 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 Peptidase_M32
Motif
Other DBs
NCBI-GeneID: 113489137
NCBI-ProteinID: XP_026720460
LinkDB All DBs
Position
27
AA seq 1332 aa AA seqDB search
MPPALGLLLWLSLASALRPGLEPPNHDPTEEGAALFASAYNSTAELVLFESVSASWNYYT
NLTTENAALQVEASLEEQNFTELWGKKAKELYGSIWSNFSDPQLRKIIGSIQTLGPSNLP
LEQREKYNTILSNMDKIYSTAKVCLPNGTCWELEPDISDIMATSRSYKKLLYAWEGWHNA
AGNPLRAKYEEFVKLSNEAYQMDGFEDTGSYWRSWYDSASFEDDLEHLYNQLEPLYLNLH
AFVRRKLYDRYGPKYINLKGPIPAHLLGKRRDPQPAPRGAGGARGAHAGPWWDSEFPVIT
VFLFLPTYHQLCSNCFLSSGNMWAQQWNNIYDLMVPYPGKPNLDVTNTMVQQRWNATHMF
RVSEEFFTSLGLLEMPPEFWDKSMLEKPTDGREVVCHASAWDFYNRKDFRIKQCTTVTME
QLFTVHHEMGHVQYYLQYKDQPVSFRSGANPGFHEAIGDVMSLSVSTPSHLKKIGLLSSA
TEDTESNINYLLKMALEKIAFLPFGYLIDQWRWNVFNGRTPPNRYNYDWWYLRTKYQGIC
APVSRNESNFDPGAKYHIPGNTPYIRYFVSFILQFQFHKALCQAAKHTGPLHTCDIYMSK
EAGAKLREVLKAGSSKSWQEILFNLTGTDKMDAGPLLEYFSPVTEWLQDQNNKTKEVLGW
PEFDWRPPVPEGYPEGIDKIADEAQAKEFLSEYNSTAEAVWNAYTEASWAYNTNITDHNK
EVMLEKNLAMSKHTLEYGMKARQFDPSDFQDQSVTRILKKLSVIERAALPENELKEYNTL
LSDMETTYSVAKVCRENKICHPLDPDLTDIMATSRDYDELLFAWKGWRDASGKKIKNNYK
RYVELSNKAAVLNGYTDNGAFWRSLYETPTFEEDLERLYLQLQPLYLHLHAYVRRALYKK
YGAEHVNLKGPIPAHLLGNMWAQSWSNIFDLVIPFPDATKVDATPAMKKQGWTPKKMFEE
SDRFFTSLGLIPMPQEFWDKSMIEKPADGREVVCHASAWDFYNRKDFRIKQCTVVNMDDL
ITVHHEMGHVQYFLQYMDQPISFRDGANPGFHEAVGDVMALSVSTPKHLHSINLLDQVTD
NKESDINYLMSVALDKIAFLPFGYLMDQWRWKVFDGRIKEDEYNQQWWNLRMKYQGLCPP
APRSEDDFDPGAKFHIPANVPYIRYFVSFVIQFQFHQALCVAANHTGPLHTCDIYQSKEA
GRILGKALKLGFSKPWPEAMELITKQPNMSADALMSYFEPLMTWLVKENEKNGEVLGWPE
YSWTPYTATPAQAGPDRTDFLGMSLAHNQATAGGWVLLALALLFLITTIFLGVKFFSTRR
KAFKSSSEMELK
NT seq 3999 nt NT seq  +upstreamnt  +downstreamnt
atgcccccggcactggggctgctgctgtggctgagcctggcgagtgcccttcggcctggc
cttgagccccccaaccatgaccccaccgaggaaggggccgccctcttcgccagcgcctac
aacagcacggctgagctcgtcctcttcgagagcgtctcggccagctggaattactacacc
aacctgacgaccgaaaacgctgctctgcaggtcgaggcatcactggaggagcaaaatttc
acggagctgtgggggaagaaagccaaggagctctacggcagcatctggagcaacttcagt
gacccacagctgaggaaaatcattggctccatccagaccctgggaccctccaacctgccc
ctggagcagagagagaagtacaacaccatcctgagcaacatggacaaaatctactccacg
gccaaggtgtgtctgcccaatggtacctgctgggagttggagccagacatctcggatatc
atggccacctcccgcagctacaagaagctgctctatgcctgggaggggtggcacaacgcc
gcgggcaacccactgcgcgccaagtatgaggagtttgtgaagctgagcaacgaggcctat
cagatggatggatttgaggacacaggcagctactggcgctcctggtatgactcagcctcc
tttgaggatgacctggaacatctctacaaccagctggagccactctacctcaacctgcac
gccttcgtccggaggaagctgtacgaccgctatggccctaaatatatcaacctgaagggt
cctatccctgctcacctcctgggtaagaggagggacccccagcctgcgcccaggggtgct
ggtggggccagaggggcacatgcagggccatggtgggacagcgagttcccagtcatcact
gtgtttctctttctcccaacctaccaccagctctgctccaactgttttctctcctcaggc
aacatgtgggctcagcagtggaacaacatctatgacctgatggtcccctaccctgggaag
cccaacctcgatgtcacaaacaccatggtgcagcagcgctggaacgccacccacatgttc
cgggtctcggaggagttcttcacctccttggggctgctggagatgccccccgagttttgg
gacaagtccatgcttgagaagccaacggatggacgggaggtggtgtgtcacgcttcagcc
tgggacttctacaaccgcaaggacttcaggatcaagcagtgcacgacggtgaccatggag
cagctcttcacggtgcaccacgagatgggccacgtccagtactacctgcagtacaaggac
cagcctgtctcgttccgcagtggggccaaccctggcttccatgaggccatcggcgacgtc
atgtccctgtctgtctccactcccagtcacctcaagaaaattggtctcctcagcagtgcc
actgaggacacagagagcaacatcaactacctgctgaagatggctttggagaagattgcc
ttcctgccctttggctacctcatcgaccagtggcgctggaacgtgttcaatggccgcaca
cccccgaaccgttacaactacgactggtggtatctgagaaccaaataccagggtatctgt
gctccagtttcaaggaacgaaagcaactttgaccctggagcaaagtaccacatccctggg
aacaccccttacatcaggtactttgtgagcttcatcctccagttccagtttcacaaggcg
ctgtgccaggcagccaaacacaccggtcccctgcacacctgtgacatctacatgtccaaa
gaggctggagccaaactcagggaagtgttgaaagctgggtcttccaagtcgtggcaggaa
attctgttcaacctcactggtacggataagatggacgctgggcccctcctggagtacttc
agccctgtcaccgagtggcttcaggaccagaacaacaagaccaaggaggtgctgggctgg
cctgagtttgactggcgtccccctgtccctgaaggctaccctgaaggcattgacaaaata
gcagatgaagcacaagctaaagagttcttgtctgagtacaacagcacggccgaggcagtg
tggaacgcctacaccgaggcatcctgggcctacaacaccaacatcaccgaccacaacaag
gaggtcatgctggagaagaacttggccatgtccaagcacacccttgagtatggcatgaag
gccaggcagttcgacccctccgacttccaggaccaaagtgtcacacgcatcctcaagaag
ctgagtgtcattgagagggcagccctgcctgagaatgagctgaaggagtacaacaccctc
ctttcagatatggagaccacatacagcgtagccaaggtctgcagagagaacaaaatctgt
catcctctggatcctgatctcacggacatcatggccacctcacgagactatgacgagctc
ctctttgcatggaagggctggcgggatgcttctgggaagaagatcaagaacaactacaag
cgatatgtggaactgagcaacaaggcagccgtgctcaatggctacacggacaatggggcc
ttctggagatccctgtatgagacacccaccttcgaggaagatctggagaggttgtacctg
cagctgcagcccctgtacctccatctgcatgcctacgtacgccgggccctgtacaaaaag
tatggtgcagagcacgtaaacctgaagggtcccatccctgctcacctgctcggcaacatg
tgggcccagtcatggtccaacattttcgatctggtgatacctttcccagatgccaccaag
gtggatgccaccccggccatgaaaaaacagggctggacaccaaagaagatgtttgaagag
tcggaccgtttcttcacctctctgggcctcatccccatgccacaggagttctgggacaag
tccatgatcgagaagccagcagacgggcgggaggtggtgtgtcacgcctcagcctgggac
ttctacaaccgcaaggacttcaggatcaagcagtgcaccgtggtgaacatggacgaccta
atcacggtgcaccacgagatgggccacgtccagtacttcctgcagtacatggaccagccc
atctcattccgcgatggggccaaccctggcttccatgaggctgtcggggatgtcatggcc
ttgtctgtctctaccccaaaacacctgcacagcatcaatctgctggaccaagtcacagac
aacaaagaaagtgacattaactacctgatgagcgttgccctggacaaaatcgccttcctg
cccttcgggtacctcatggaccagtggcgctggaaggtgtttgatgggcggatcaaggag
gatgagtacaaccagcagtggtggaacctcaggatgaagtaccagggcttgtgcccacca
gcaccaaggtctgaagatgactttgaccccggggcaaagtttcacatccctgccaatgtt
ccctacatcaggtactttgtcagctttgtgatccagttccagttccaccaggcgctctgc
gtggcagccaaccacacgggtcccctgcacacgtgtgacatctaccagtccaaggaggct
gggaggatcttggggaaggccctgaagctgggtttcagcaagccgtggcccgaagccatg
gagctcatcacaaaacagcccaacatgtcagctgatgccctgatgagctactttgagcca
ctcatgacatggctggtgaaggagaatgagaagaacggggaggtcctgggctggcctgag
tacagctggactccttacacagccactccagcccaagctggccccgaccgaactgatttc
ctgggcatgtccctggctcacaatcaagccacagcaggcggctgggtcctgctcgccctg
gctctcctcttcctgatcaccaccatcttcttgggtgtcaagttcttctcaaccaggaga
aaggccttcaaatccagctcagaaatggaactgaaataa

DBGET integrated database retrieval system