KEGG   Athene cunicularia (burrowing owl): 113489146Help
Entry
113489146         CDS       T05777                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun04010  MAPK signaling pathway
acun04210  Apoptosis
acun04625  C-type lectin receptor signaling pathway
acun04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:acun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113489146 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    113489146 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113489146 (MAP3K14)
   04672 Intestinal immune network for IgA production
    113489146 (MAP3K14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acun01001]
    113489146 (MAP3K14)
Enzymes [BR:acun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     113489146 (MAP3K14)
Protein kinases [BR:acun01001]
 Serine/threonine kinases: STE group
  Other
   113489146 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 113489146
NCBI-ProteinID: XP_026720474
LinkDB All DBs
Position
27
AA seq 943 aa AA seqDB search
MAVMGITCQGAPDPPVKHKKELTATKGLNETVSEKQSSVCKVEDSENVIFHSQWKILNDV
ITKGTAKEETEGGCASISIIAQAECENSQEFSPTLSERSFIAHSKRYSRSDSLDQIPNNV
AHATEGKMAPTCWRGRHRGKTKKKRHKKRSKLKIQTVAAGRRGPRTPEQESCTPIPVQED
ESHQNILYRNSFWVSEFNKDLVYDPLPFEKPEKVLPTGKLHSPRSQYKTELHKLISPIQC
LNHVWKRHYQRDSVPQPETLHPFPYNIIPPHFPHLDSPLHAMKHNALETYLHGELNYQDS
EHRLSGLNFDYSFPKCINQSMKTSSDKISVEEYLVDALKGSVSLGEPQNLASLAKTWRGG
GLDPKEQFHEADENEGVLLNEKLKPVDYEYREEVHWTKCHGSLGIGSFGEVYKIEDKQTG
FQCAAKKVQVEHFRAEELTTCAAITSPKVVPLYGAVKEGPWVTIFMKLMEGGSLGQLIKQ
SGCLPEDRALSYLGQALEGLEYLHAQNILHGDVKAENVLLSDDGSRALLCDFGHSAHLHP
DGLGKCLVTGNYVPGTETHMAPEVVMGKRCDSKVDVWSSCCMMLHMLNGCHPWTQYYNHP
LCLKIAKEPPPLREIPPSCNPLTAEIIKMGLEKEPVQRASASELKTKTSVALEEVGGVTS
PWKGEYREPRHLSLNKENNPQTSLSPTVSPVSETDSDPKLPVKVSCASPVLPPPSLEHTE
EVEGTPWNVCKELSETWDPPPLSSTPLPLKSCGHAERATTISEQELQQLEIELFLNSLSQ
PYSLEEQEQMLSCLSIDSPFVSDASEKNSMKTSHSLRDTMSSGIHSWNSQADGQSFSWNN
LLNRSRHTDTPSYFNGVKIQIQLLSGENLHIRDFHRTKVGDIATGISSQIPVPAFSLVTK
EGQPVHYDMEVPDSGIELQCTLAPDCSVSWTWRVKHGQLENRP
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatgggaattacgtgccaaggagctcctgatccacccgtcaagcacaagaag
gagctcacagctaccaaggggctgaacgagacagtgagtgaaaagcagagcagtgtttgc
aaagtagaagattcagagaatgttatctttcacagtcagtggaaaatcctgaatgatgta
attaccaaaggaacagcaaaagaagaaacagaaggaggctgtgcatcaatttctattatt
gcccaagcagaatgtgaaaacagtcaggagttcagccccactttatcagagagatccttt
attgctcatagtaagcgttacagccggtcagacagtctcgatcaaatccctaacaatgtg
gcccatgcaacggaggggaagatggcacctacctgttggagagggaggcatcgcggtaag
acgaaaaagaaacgtcacaaaaaaagatccaagctgaaaatacaaacagtggctgctggt
aggcgaggtcccagaactccagaacaagagagctgcaccccaattcccgtccaggaggat
gaatcacaccaaaatattctttacagaaacagcttttgggtttcagaatttaacaaggac
ttggtctatgatccgctgccatttgagaaacctgagaaagttctgcctacgggcaaactc
cattcaccaaggagccaatacaaaacagaactgcacaagttgataagccctattcagtgc
cttaatcatgtttggaaacggcattatcagagggacagtgttccacagcctgaaactctc
catccttttccctacaacataataccccctcatttcccacatctggacagtcccctgcat
gccatgaaacataatgctttggagacatacttgcatggtgaactcaactatcaggacagt
gagcatcgcttatctggcctaaacttcgactatagtttccccaaatgcatcaaccagtcc
atgaaaaccagttcagacaagatttctgtggaagaatacttggtagacgccttgaagggg
agcgtgagcctcggtgaaccacaaaatttagccagcctagccaagacgtggagaggaggt
ggcctggacccaaaggaacaattccatgaagcagatgaaaacgaaggcgtgctacttaat
gagaaactaaagccggtggattatgagtaccgagaagaggttcattggaccaagtgtcac
ggttctttgggcattggctcttttggagaagtatacaaaatagaggacaaacagacagga
tttcagtgtgctgccaaaaaggtgcaagttgaacacttccgtgcagaggagttaacgaca
tgtgctgcaataacgagtcctaaagttgtccccttgtatggagctgtgaaggaaggacct
tgggtgaccatcttcatgaagctgatggagggtggctcactaggtcagctaattaagcag
agtggctgcctgccagaggacagagccctcagttatttgggccaggcattagagggcttg
gagtatcttcatgctcaaaacattctccatggagatgtaaaagcggaaaacgtgctcttg
tctgatgatggaagcagggctcttctgtgtgactttggtcactctgctcaccttcatcca
gatggcctgggaaagtgcttggtcacagggaactatgtgcctggcacggagactcacatg
gccccggaggtggtcatgggaaagcgctgcgactccaaggtggatgtctggagcagctgc
tgtatgatgctgcatatgcttaacggatgccacccttggacacagtattacaatcacccg
ctctgtctgaagatagctaaagagccaccccctctgagggaaattccaccttcctgcaac
cctctcactgctgagattattaaaatgggtctggagaaagagcctgttcagagagcatct
gcgtctgagctgaaaactaagaccagtgttgcacttgaagaagtgggaggtgtgacaagc
ccctggaaaggtgaatacagagagcctagacatttatctttgaacaaagaaaacaatccg
cagacgtccctgtcccccacggtgagcccagtttctgagactgattctgacccaaaattg
ccagtcaaagtttcttgtgcgagcccagtcctaccaccaccatccctggagcacacagag
gaggtcgagggaaccccttggaatgtgtgcaaggagttatctgagacctgggatcctcca
cctctctcctcaactcctctccccctgaagagctgcggccatgcggagagagcaacaacc
atttcagaacaagagcttcagcagctggaaatagaactgtttttgaacagcctttcacag
ccttactcgctggaagagcaagaacaaatgctttcatgtctcagcatcgacagcccgttt
gtgtcagatgccagtgagaagaactccatgaagacttctcatagcttgagggacactatg
agctctgggattcactcctggaacagccaggcagacggacagagcttcagctggaacaac
ctcctgaaccgcagtcggcacacggacactcccagctatttcaacggagtaaaaatccaa
atccagttgctaagtggagaaaatttacacatcagggatttccacaggacaaaggtggga
gacattgccactgggataagcagccagataccggtccctgcttttagcctggttacaaaa
gaaggccagccggttcactacgacatggaggtccccgactctggtattgagctgcagtgc
acccttgcccctgattgcagcgtcagctggacatggcgagtcaaacacggtcagctggag
aacaggccatga

DBGET integrated database retrieval system