KEGG   Athene cunicularia (burrowing owl): 113490288Help
Entry
113490288         CDS       T05777                                 

Gene name
PCSK1
Definition
(RefSeq) neuroendocrine convertase 1
  KO
K01359  proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
acun  Athene cunicularia (burrowing owl)
Brite
KEGG Orthology (KO) [BR:acun00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:acun01002]
    113490288 (PCSK1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:acun03110]
    113490288 (PCSK1)
Enzymes [BR:acun01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     113490288 (PCSK1)
Peptidases [BR:acun01002]
 Serine Peptidases
  Family S8: subtilisin family
   113490288 (PCSK1)
Chaperones and folding catalysts [BR:acun03110]
 Intramolecular chaperones
  Subtilisin family
   113490288 (PCSK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein Proho_convert
Motif
Other DBs
NCBI-GeneID: 113490288
NCBI-ProteinID: XP_026722435
LinkDB All DBs
Position
Z
AA seq 624 aa AA seqDB search
MWNQQWYLQDTRVTPTLPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYTNYDPK
ASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNRKCGVGVAYNSKVGGIRMLDGI
VTDAIEASSIGFNPEHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGIKQGRNGKGSIFV
WASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATAYSSGDYTDQR
ITSADLHNECTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPLAGNP
GWKKNGAGLMVNSRFGFGLLNANALVDLADPKRWKGVPEKRECIVKDKSFEPRLLRANEE
VIIEIPTKACEGQENSIASLEHVQLEATIEYSRRGDLHVTLASPSGTSTVLLAERERDKS
PNGFKNWDFMSVHTWGENPTGTWVLRITDVSRRIQNEGRIVNWKLILHGTATQPEHMKQP
RVYTSYNAVQNDRRGVEKMTDSVEDHTTQENLREKPKVTEDPSSSSEKAEDKIPSEAMLH
LLQSAFSRQMAQKRLPKKTASEKLNIPYEHFYQALEKLNKPSQLRDSEESLYSDYVDLFY
NAKPYKHRDDRLLQALVDIINEGN
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgtggaatcagcagtggtatctgcaagatacaagagtaactccaaccctgcccaaactg
gatctccacgttattcctgtatggcagaaagggattacaggcaagggggtggtcatcacc
gtactagacgatggcttggagtggaatcacactgacatctacactaactatgatccaaag
gcgagttatgatttcaatgacaacgaccatgatccatttcctagatacgacccgacaaac
gaaaacaagcatgggacacggtgtgcaggagaaattgccatgcaagccaacaacagaaaa
tgtggagttggagtagcctacaattccaaagttggaggtatacgaatgctggacggaata
gtcactgatgctattgaagccagttcaatcggtttcaatccggaacacgtggatatttac
agcgcaagctggggccctaatgatgacggtaaaaccgtggagggacctgggagactggca
cagaaggcttttgagtatgggataaaacagggccggaatgggaaaggctccattttcgtc
tgggcttctgggaacggaggccgtcagggagacaactgcgactgtgacggttacactgat
agtatctacactatctccattagcagtgcttctcagcaaggcctttctccctggtatgca
gagaagtgctcttcaactctggccaccgcatacagcagtggggattatactgaccaaaga
attacaagtgctgatcttcacaacgaatgcaccgagactcacactgggacctctgcgtct
gcaccactggcagcaggaatttttgccctagccctggaagcaaacccaaatctaacctgg
agggatatgcagcacttggtggtgtggacctcagaatacgatccactggctggaaatcca
ggatggaaaaagaacggagcgggactgatggtcaacagcagatttgggtttgggctcctc
aatgccaacgcgctggtagatttagctgatcccaagagatggaaaggggtaccagaaaag
agagagtgtattgtcaaagacaagagctttgaaccaagattattaagagccaatgaggaa
gtcatcattgaaattcccacaaaagcctgcgagggtcaagaaaactccattgcatctctg
gaacacgtgcagcttgaggcaacgattgagtattcccgtagaggtgatctccacgtcact
ctggcatctccatcagggaccagcactgtcttactggctgagagagagagagataaatct
cccaatggctttaagaactgggacttcatgtctgttcacacctggggagagaacccaaca
ggcacctgggttctaagaattactgacgtgtccagaagaatacaaaatgaaggaaggatt
gtaaactggaaattgattttgcatggcactgctacccagcccgaacatatgaagcagcca
cgtgtgtacacatcctacaatgctgtgcaaaacgacaggagaggagtggagaagatgacg
gactctgtagaggaccacaccacacaggagaacctgcgtgaaaagcctaaagtcacagaa
gatcccagtagcagcagtgagaaagcagaagataaaatcccatcagaggctatgctacat
ttgctgcagagcgcttttagcagacagatggctcagaaacgactgccaaagaagacggcg
agtgagaagttaaatattccgtatgaacacttctatcaagccctcgaaaaattaaacaag
ccctcccagttgagagactcagaagaaagtctgtacagtgactacgttgatcttttttac
aatgccaaaccatacaagcatagagatgacagactgctgcaagccttggttgatattata
aatgaaggaaactaa

DBGET integrated database retrieval system